OvationPro2.54(22-Sep-99) d6HSVnd( tJ  PlPlL L xK1T @0   t1.1 to 3.263.26n%  !GenericBlackfWhitefTransparent fRedfGreenfBluefCyan!fMagenta!fYellow !fRegistration AfBlack01 f `.HSVn:Pff. @H@;x4V?e.%Gl<,V]}?_9h Dk{ <z0;*$:9n 8ߜFb"V[bs./&{.s&Trinity.Medium.ItalicBlackFace.BoldSelwynSwiss.Cond.BlackLondonA.BoldTrinity.Bold.ItalicLondonA.SmallCaps.DemiBoldHomerton.BoldCienHomerton.Medium.ObliqueLondonA.DemiBold.ItalicWeddingHomerton.Bold.ObliqueHomerton.MediumTrinity.MediumTrinity.BoldSassoon.Primary.BoldBlackFace.Bold.ExtendedLondonASwissack @@ HBodytext#''+\+'0P33 Main Heading,GPFPFX:0P33lH Listext ..40P33l' J Hanging Indent( :;**00P33& r]7Sub heading,G..(; 0P33H0 Paragraph:;..40P33`* Tablext :;..+40Pf&`* 4Contents  :;66). .=0P33p1 1Drop Caps:;**00X33& Reverse8..70P33+ Cluesxt( :;''$,0P33P# nFLife MembersV]@8.40PR8D( Highlighth''+0P33R! Results :;**00Pf&& ӆDrop capital2''+\+'0X33  H| eg8 ''\+'0P33 eg8''\+'4P33 NV,GPFPFX':0P33lH eg8 {ppDV'2P33 eg8DkPFPFLR'0P33C eg8DkpbPFLR'0P33C eg8z''-'2P33$ V''\+'0P33 eg8''\+'0P33 V''\+'0P33 3Q"''\+'0P33 J !''\+'0P33 J Q &''\+'0P33 r]7eg8+''\+'0P33 eg86V]'','2P33! eg88z''-'2P33$ eg8?''\+'0P33 eg8A''\+'2P33 ,M,GPFPFX':0P33lH eg8Pz''-'2P33$ VQ''\+'0P33 eg8k z''-'0P33$ eg8m :;>>`F'0P338 *X p,G..(;' 0P33H0 Zq,G..(;' 0P33H0 _hv''\+'0P33 *X x,G..(;' 0P33H0 eg8z {ppDV'4P33 eg8{z''-'2P33$ eg8}z..6'2P33@, eg8~z66t?'2P333 eg8z''-'4P33$ eg8z''-'0P33$ eg8V]66t='0P33. eg89k66t>'0P33. eg8 :;>>`F'0P338 eg8..4'2P33l' eg8..4'0P33l' eg88]]o'2P33W eg8]]h'2P33N eg8..4'4P33l' eg8..4'0P33l' I+,..4' 0P33l' J 3Q"''\+'0P33 J eg88..7'0P33+ eg8''-'2P33D% eg8:;''$,'0P33P# eg8 :;PFPFLtO'0P33? eg8:;''$,'2P33P# eg8..4'0P33l' eg8V]**0'2P33$ _h**/'0P33#$ eg8z**02'2P33( eg8 **02'0P33( NV,GPFPFX':0P33lH M 66t). .<'0P33- 1%,G..(;' 0P33H0 *X ,,G..(;' 0P33H0 eg82z**02'2P33( eg8K;''-'0P33# P''\+'0X33 eg8R {ppDV'4P33 eg8SDkpbPFLR'0P33C eg8TDkPFPFLR'0P33C V] Dk.. 7'0P33, %d,G**:6' 0P33B, 3Q"e**/'0P33#$ J eg8g''\+'2P33 eg8o"ߜ66t='2P332/ eg8rDk''-'2P33D% 3Q"t''\+'0P33 J eg8vz''-'4P33$ eg8wz''-'0P33$ eg8x''\+'4P33 eg8y''\+'0P33 3Q" }%?''%'0P33 J eg8DkPFPFLR'2P33C 5p,GPFPFX':0P33lH eg8z''-'0P33$ eg8%?''%'0P33 :5,GPFPFX':0X33lH [:''\+'0Pf& 4eg88..7'0P33+ W_''\+'0Pf& 4y,G..(;' 0Pf&H0 4[:V]'','0Pf&! 4eg8V]..4'0P33D( _h(#(#''0P33 CV]@8.4'0PR8D( *X ,G..(;' 0P33H0 NV ,GPFPFX':0P33lH eMH''\+'0X33 eg8(#(#''0P33 _h V]'','0P33! Q  ''\+'0P33 r]7eg8z''-'2P33$ W_V]'','0Pf&! 4Q ''\+'0P33 r]7eg8Dk.. 7'2P33, eg8Dk''-'2P33D% eg8Dk''-'2P33D% CV]<2~U9'0PR8+ eg8#]]@n'2P33pY eg8$]]@n'2P33pY eg8%z66t?'2P333 eg8'zPFPFL R'2P33`B eg8+z66t?'2P333 eg8Pz66t?'2P333 V]''\+'0P33 V^''\+'4P33 /%g''\+'0P33 J R"'h,GPFPFX':0P33lH ۳lh''+'0P33R! %(v''\+'0P33 J NV,GPFPFX':0P33lH _h''\+'0P33 `9''\+'0P33 r]7eg8 z22~P;'0P33/ 3Q"''\+'0P33 J eg8]]@n'2P33pY eg8%?''%'0P33 _h''\+'0P33 eg8:;0u0ul'2P33i CV]@8.4'0PR8D( CV]<2~U9'0PR8+ eg8<0u0u'2P33e eg8<''+'2P33! _hz66t?'2P333 466t). .<'0P33- 1_h %?..0-'2P33p& eg8%?''%'0P33 3Q"> ''P\+'0P33 J MN 66@). .<'0P33- 1_h'','4P33p! ۳h''+'0P33R! _h'','0P33p! [:V]'','0Pf&! 4eg8 ''\+'0P33 M66t). .<'0P33- 1UQ''\+'0P33 _hV]'','0P33! 3Q"%?''%'0P33 J _h''\+'0P33 ''\+'0P33 ='','0P33p!  ''\+'0P33 ,!''\+'0P33 _h'','0P33p! _h''\+'0P33 _h3 ..4'0P33l' _h %?..0-'0P33p& _h ..04'0P33l' NV,GPFPFX':0P33lH ,G`TPFX':0PR8lH %''\+'0P33 eg8&&''P-'0P33$ eg8G&&''P-'4P33$ eg8&&''P-'0P33$ eg8V]..4'0P33D( _h..4'0P33l' _h''\+'0P33 Rz:''\+'0X33 C V]@8.4'0PR8D( _hV]'','0P33! M66t). .<'0P33- 1宠 ''\+'0P33 }%''\+'0P33 宠  %?..0-'2P33p& =7''\+'0P33 }%''\+'0P33 =7''\+'2P33 =7 %?''%'0P33 =7!''\+'0P33 _h)''\+'0P33 ۳+h''+'0P33R! Xgz2''\+'0X33 Z 3''\+'0P33 _h8''\+'0P33 R"':,GPFPFX':0P33lH _h=V]'','0P33! *X B,G..(;' 0P33H0 *X CDk.. 7' 0P33, yU,G..(;' 0Pf&H0 4yX,G..(;' 0Pf&H0 4N( Z''\+'0P33 *[''\+'0P33 NVd %?..0-':2P33p& eg8fz..6'2P33@, eg8hzPFPFL R'2P33`B CpV]@8.4'0PR8D( C qV]:0 7'0PR8) ۳~h''+'0P33R! ,GPFPFX':0Pf&lH 4%,G..(;' 2P33H0 *X ,G..(;' 2P33H0 K-V]'','0Pf&! 4W_''\+'0Pf& 4W_V]'','0Pf&! 4 ''\+'0P33 ۳h''+'0P33R! y^+,GPFPFX':0P33lH  '<h''+'0P33R! _h''\+'0P33 *X ,G..(;' 0P33H0 _h'','0P33p! _h''\+'2P33 NV,GPFPFX':0P33lH c'*''\+'0P33  ''\+'0P33 1z ,G..(;' 0P33H0 eg8''\+'0P33 8''\+'0P33 M66t). .<'0P33- 1M 66). .<'0P33- 1"R# y)U)-H9C,^IMsV8Z]Z`^=abtb!bc^hHi ldqu={}w:fN[RŞr,­p: ^j\0|hm| }  f=@4!m##D%X'*}-/W177.9 d=p>)%D:DDIZqZ[ihz5}(؁ UFf6$=GEy{,!? 8wZEX!!+9DD]XN5P PZ]_^eb!bbbnqw(~`7/:NX­ݲA)d f,IqV1| } 4!D%X}-W177-9 .9 >)/AdBC%DIUBZqZ[E\mqoq:tJz{YC=H%=&(#=FJL!i'p |?y?7f%=&(#=FJL!i'p |?y?7 3=0_h<DNVP,X3Q"d lVtQ | 宠 *X 1z 5pW_8۳XgzCUQ%M(0<yDeMHPZXdN( pZ x,!/%}%%R"'%(*c'*y^+I+,K-4:5 =70eg88R`9<Rz:H[:T '<`)&&CB@67Einit872 !(&E;87*)&8701=;DEB@72 X@@  J  rӆ4 14,/LlD]7yd3>K,_( K,V !MainDict!UserDict!IgnoreU @Ċ @Pn  %PlL A5 () tt  PlL  LL   ^Widr]7n97l`TCyH%",,e+w^%RtI $  0X]7nXoB @JkP ,^ \+ LL RIPPLESJJJP ,A - D @@wespP ,$ P- t PlL JLL n^WidKnn97l`zyH%",,bw^%RtI $  0X]7  !XoB  D RIPPLESpPP ,_ P-0 @ lP! ,$ P-JP%& PlL A5 () t $t& 0PlL % a`L' E0n^WidKnn97l`zyH%",,bw^%RtI $  0X]7 ()X@oB@  ``(L`L`L`Contents Committee 1999S 2 EditorialK4 3 Chairmans Report\ 4 Fund Raising Pledges- 5 Cooking on the Cut( 10 Revised Map of the Link 12 Mercy, Mercy on the Merseyu 14 Souvenir Video 18 Suppose Edgar Allan Poe Used a Computer+H 19 1999 Campaign Cruise AwardsG 20 Supporters 23 Life MembersE 24 Boat Jumbles[ on back coverCommittee 1999 ,,,President: Rt Hon Sir Robert Atkins tChairman$Cliff Fazackerleyd}&t 01772 433273 Vice ChairmanFrank Parker}&t }tt01772 717367 Secretary5Vivien Carter}&t t01706 813422 Treasurer3tGeoff Driver }&t t01772 798180 Minutes SecretaryJSu Page}&t t01254 57945 Membership SecretarypChris Gulley BW Public Relations John CleggV}&t t01257 271198 Environmental<John CleggV}& t}tt01257 271198 Committee MembersL}Ted EllisDMartha Finch8 Ken HudsonPeter Lang Chris LoweVGeorge Nickson Irene ParkerJohn Young Terry Tomlinson AWCC}t Nomineesh$A SmithI>WAt National L LoweI>WAt North West Region R SymondsVNorth Lancashire & Cumbria S Henstock~Lancaster Canal Boat Club D SlaterLancaster Canal Trust tG StokesbACE D YatesLCCtEditorial 8888888As a bit of relaxation after the rather busy few days of the Maritime Festival I spent a couple of days scrubbing down the white Tyrolean rendering on the house with an old (well it is now!) car washing brush and hosepipe to get rid of a couple of years growth of green algae. Next on the agenda was a day out a circular trip via Daisy Nook Country Park which is based around the Hollingwood and Fairbottom branches of the Ashton canal, Stalybridge where work is just starting on reinstating the canal through the town centre and Whaley Bridge to visit the re-watered Bugsworth Basin. Next it was down to updating the web site. Theres extracts from the June edition of Ripples, updates to various sections due to a change in the route upstream of Tom Benson Way on there now. When Ive finished this edition of Ripples I should soon have a new page for uploading with the photos I took on Thursday from the river and on Friday from the bank opposite the entrance to Savick Brook and at the Marina. Many thanks from my wife and myself go to Dave Dawson and his son Paul for the very smooth trip from Tarleton to Preston aboard Bosworth8. We even had the Eurofighter as an escort at one point! Sods Law strikes again! After printing a map of the route of the Link in the June issue it has had to be shortened by removing the section through Haslam Park. This decision has been taken because of escalating costs due to the various delays in starting the work not being matched by additional funds. The Link will therefore take a sharp left turn at point just up-stream of the tunnel under Tom Benson Way and run roughly parallel to Tom Benson Way up three locks to a basin at its junction with the Lancaster Canal. The optimists say an October start of construction the pessimists say a November start but definitely before the end of the year. We also have for sale the remaining copies of the first edition of Ian Bottrills book of short boating stories, Well, Eye Bee Blowed which went on sale at the Maritime Festival. It contains all the stories which have been printed in Ripples, some with additional content, and others which have not been published before. The book costs 4.95 including p&p with all profits going towards the Link, contact me me if you would like a copy. =John Clegg:Chairmans Report 88In the first week of September the Ribble Link Construction & Operations board received a joint recommendation from the Babtie Group and British Waterways that ~Gleesons should be the contractors selected to move the Ribble Link project forward. During the Saturday evening of the cruise weekend, it was announced that ~Gleesons will now spend the next few weeks checking over the project details with Babtie and British Waterways. On completion of this task they will sign a formal contract and building work will start around the end of October. I have had informal discussions with the project manager and she is optimistic that they will complete the project to allow our inaugural cruise in September 2000. Once a full program of works is complete we will reassess the situation and start planning the opening ceremony. The weather for the last campaign cruise was extremely good to us, with everyone appearing to have a good time and, in fact, everything seems to have gone off without a hitch. The seventy boats that joined the cruise from Tarleton made a colourful display in the dock. On both Saturday and Sunday a procession of boats cruised around the basin in celebration of the Trusts success to the delight of the general public. Partnership Projects Ltd, the main organisers of the Festival under the leadership of Andrew Harris, arranged numerous events to take place in and around the dock ensuring that there was plenty to see and do over the weekend. On the Saturday evening the entertainment in the marquee was ~Penn & Page a comedy duo and during the interval the Ribble Link Award winners were announced. The Mayor of Preston Borough, Councillor Jeff Swarbrick and the MP for South Ribble, David Borrow attended to hand out the trophies. The prizewinners are listed elsewhere in this magazine. Several boats entered the illuminated parade on the Sunday night making a spectacular display. To round off the event the organisers brought the weekend to a close with a spectacular firework display thanks to the generosity of Preston Borough Council, Preston Marine Services and Millennium Pyrotechnics,. Once again my thanks go to Frank and Irene Parker, along with a number of people who assisted them (including the escort craft), for organising the cruise. Everyone worked extremely hard to get all the boats into the dock and then back again to Tarleton. Congratulations to one and all on a job well done. We are still continuing to try to raise money to ensure the scheme can be completed to the best standards, therefore my usual cry goes out for help. I must add that during the Cruise we had several donations ranging from 5 to 1000. Thanks once again to all of you whose contributions are listed below. By allowing all donations to go via Lancashire County Council, who will ensure they go through a Landfill operator, the benefit is multiplied tenfold. Please dont be concerned if it takes a while before your cheque is cashed, all is in hand. Best regards,  Cliff Fazackerley  Chairman:XU :Fund Raising Pledges UPersonal / Boat ClubEAmountmDate received North Lancs & Cumbria IWAQ500fJan 98 North Lancs & Cumbria IWA>5000zx IWA RegionY500 Mar 99 Lancaster Canal Boat Club0500X Nov 97 Wheelton Boat Club500jJun 98 Lancaster Canal Trust,1000X Nov 97 Bridgewater Boat Clubx500 Dec 98 North Cheshire Cruising ClubM250bFeb 99 ACE100jJun 98 ELWY@100zx Mersey MBCJ250X Nov 98 Brian & Marian Whittaker z100bFeb 99 IWA memberG300bFeb 99 K J & S M Hudson 500July 97 Mrs V Carter (.5)500July 97 C & P Fazackerley (.5)500 Aug 97 J Young (.5)a500 Aug 97 J Wilkinson (500 Labour only)R0 DM & DH Melluisht500 Mar 99 Illuminated cruiseH220Jan-Apr 98 I Bottrill1000bFeb 98 Chris Gully (.4)1000 Aug 97 R Symonds(donation)525 Aug 97 Ted Ellis1000zx Grampian r500 Aug 97 Colin Brooks Design2000July 97 Brain Fairhurst \+100fJan 98 Martha (donation)10bFeb 98 Ken Abrams Transport100bFeb 98 Marsdens Cranes(40 Mar 98 Dave Morrison / Lynbrook150 Mar 99 Photo Enlargement donations6k36 Mar 99 Virgin N.W. Trainsr400 Mar 98 Chris Miller Cranesv100|Sept 98 J DinwoodeyNu5ZApr 98 D FaulknerV5ZApr 98 R Forshaw (LM)b101ZApr 98 J & C Nestor (LM)150ZApr 98 Jack & Irene Staziker (LM)100ZApr 98 J Butcher (LM)@50jJun 98 J & M Carr (LM)V 120May 98 D. Leach (LM)81101May 98 R Nicholl (LM):50jJun 98 P Williamson (LM)50ZApr 98 P & F Wrigley (LM)105May 98 D Jackson (LM)v450jJun 98 R James (LM)A100jJun 98 P Unsworth (cans)33F Jul 98 Mrs F GlynneT20F Jul 98 Mr M Henstock (LM)6100F Jul 98 Mr H Mayor (LM)8100F Jul 98 P & P Lang (LM)$ 200 Aug 98 P Lang ( Donation) 35 Aug 98 Caroline, Hazel, Louise (Face Painting)23.50HAug 98 R Symonds (Donation)70.50HAug 98 N L Walling (LM)100X Nov 98 Phil Unsworth (cans)12X Nov 98 Donations received at AGMN48X Nov 98 LCT donationN50 Dec 98 T Tomlinson (LM)100 Dec 98 R Leeming (LM)110 Dec 98 D Morrison (LM)100bFeb 99 Toy machineBT587 Mar 99 Hi Tech Plastics(151 Mar 99 A Chatterton&a10ZApr 99 Dr Dawsonx10ZApr 99 P McCormickhe5ZApr 99 Rev. GR Richens (LM)*100ZApr 99 C H Bagot (LM)100ZApr 99 S E Bagott100ZApr 99 A & JM Abbott\:10ZApr 99 P Beever6ZApr 99 GB & B Dawes6=10ZApr 99 J Dinwoodey*b10ZApr 99 DC Fulkner5ZApr 99 M & KM Gray2A20ZApr 99 G Jacksonʏ20ZApr 99 J Southworth (LM)@100ZApr 99 R Womersley (LM)&100ZApr 99 J Massey (LM)7100May 99 South Pennine Boat Club<50May 99 D DunderdaleBO50jJun 99 Dr E Ellis (LM)&100jJun 99 R F Forshawj18jJun 99 G Nickson (LM)&*50jJun 99 Miss E Sibbert (LM)110jJun 99 Mrs L Simpson (LM)110jJun 99 D Suleman5jJun 99 R Symonds{10jJun 99 K G Green (LM)100jJun 99 TotalD23417zx _zx Halifax B SV2000May 97 Chris Gulley Rig Donation:500ZApr 97 X Ribble Link Trust - ContributionsU Geological survey785zx Land RegistrationJ 250zx RLT brochures5270zx RLT brochures (re-print)b175zx RLT brochures (re-print)b218zx PBC Planning>!717zx Fund raising literaturef600zx RLT environmental work300zx Babtie Millennium Bid2350zx Babtie Enviro survey&2350zx Babtie Contractors list2056zx Registration to Entrust100zx Novotel (sponsor room)Z480zx Babtie (report)&1175zx Babtie (report)&1581zx RLT Cashh3600zx RLT CentreM3500 TotalD20507Cooking on the Cut Sweet Potato Hash 8Try this as a change from boiled, mashed or baked potatoes. Serves four. Ingredients:Z1lb sweet potatoes, peeled and cubed K,gm12oz potatoes, peeled and cubed K,gm2 tablespoonfuls olive oil K,gm2 leeks, sliced K,gm1 medium onion, thinly sliced K,gmSalt and freshly ground black pepper K,gm2oz Gruyre cheese, grated8 8Cook the sweet potato and potato in a pan of boiling water for 1015 minutes until tender. Drain and mash coarsely, leaving some chunks of potato to add texture. Heat half the olive oil in a medium frying pan, add the leeks and onion and cook over a medium heat for 5 mins until softened and lightly browned. Add to the potatoes, season to taste and mix well. Heat the remaining oil in the clean frying pan, add the potato and leek mixture and fry for 35 mins until the base is golden. Scatter with the grated cheese then put the pan under a hot grill until the cheese is melted and bubbling. Serve immediately8. 8A frog goes into a bank and approaches the cashier. He can see from her nameplate that her name is Patricia Whack. So he says Miss Whack, Id like to get a loan to buy a boat and go on a long holiday. Patti looks at the frog in disbelief and asks how much he wants to borrow. The frog says 50,000. 8The teller asks his name and the frog says that his name is Kermit Jagger and that its OK, he knows the bank manager. Patti explains that 50,000 is a substantial amount of money and that he will need to secure some collateral against the loan. She asks if he has anything he can use as collateral. The frog says Yes, I have this. and he produces a tiny pink porcelain elephant, about half an inch tall. Its bright pink and perfectly formed. Very confused, Patti explains that shell have to consult with the manager and disappears into a back office. She finds the manager and reports Theres a frog called Kermit Jagger out there who claims to know you, and he wants to borrow 50,000 and he wants to use this as collateral. She holds up the tiny pink elephant. I mean, what the hell is this? So the bank manager looks back at her and says Its a knick knack, Patti Whack. Give the frog a loan. His old mans a Rolling Stone.8Mercy, Mercy on the Mersey 8Easter approached and our first proper cruise of the year. Our usual foray was to Middlewich, well Croxton aqueduct due to our 9ft beam. Then the news of the bank collapse into the canal at Anderton filtered through and put the mockers on that plan. We considered a shortened journey, no didnt fancy that. Up to Skipton? Maybe, but we were going there in the summer. What to do? Then a plan started to form always a danger when this happens. We still had our Sea Worthiness Certificate from last year as it didnt run out until the end of May. Yes! thats what wed do, down the Ship Canal on to the Weaver in at Ellesmere Port on to the Shroppie and back. Hmm! Already the return journey was formulating in my mind Say nothing at this stage. I thought. So that was it and on Sat 27th8 March we set off for Castlefield in brilliant sunshine, my wife Lynn our son Sam and two dogs Bess and Domino. Little did they know what I was planning. On Mon 30th8 we went down the Ship Canal and on to the Weaver. Cruised on the Weaver which is little used. We were the first boat to go through Vale Royal lock since last year. On to the Ship Canal on Sat 3rd April and in at the Boat Museum to join the yearly Working Boat gathering and very good it was too. We moved on Sunday afternoon and spent the next day in Chester. I pointed out to Sam where Julie Anne had been built. David Jones (Taylors) and the man who actually worked on her, Alan Parry, who now runs two wooden trip boats on the Dee. We continued on to Nantwich and I think it was here that I first mentioned to Lynn that it might be better to come back via the Mersey, all casual like, after a meal and several drinks, quickly adding that it would be cheaper and also quicker. She didnt appear fazed probably due to the bottle of wine and the memory that last year, on the organised cruise, it was like a mill pond. All settled then and so on Sunday the 11th8 at 6.15 am first light we set off along the Ship Canal for Eastham Dock. I had checked with the Met Office on several occasions and they forecast light winds in the morning turning stronger in the afternoon. As we had arranged to dock in at Langton between 8.00 and 8.30am on the high tide it should be fine. As we docked at Eastham the Harbour Master informed us that there was a bit of traffic about and to keep well over in the channel. I had already planned this I assured him. He then spotted our dogs and asked if Langton were aware we would be taking dogs into the Port as they may put them into quarantine. I honestly thought he was joking but he wasnt. Anyway, to cut a long story short I stated that I acknowledged his comments and said we would sort it out at Langton. In actual fact we kept them out of sight but I cant believe there would have been a problem. We left Eastham in a lightish breeze and made steady progress. Its about eight or nine miles in all and I calculated we should do it in about an hour, an hour and a half at worst and this is actually the time we did it in. About a mile out I saw a ship following us in the distance, and just as the channel started to widen to the north it went past. All I could see was this enormous mountain of water being pushed by its bows, it really was moving. I must admit to an odd heart flutter as this monster flew past no more than fifty yards to our port. We then had a taste of what was to follow as the waves hit us Its not too late to turn back." I thought, but as the waves gradually subsided I rationalised that in another mile or so we could stay well out of the way of any other ships. Of course, as you can imagine, Lynn was not amused and Sam had gone a kind of green colour. The wind decided at this point to intensify and what I thought, at first, to be the remaining waves of our passing friend was in fact the norm. Slowly the weather deteriorated further and the water got heavier. Waves were now coming over the bow and I had to put the wiper on. As we approached Brunswick Marina I did seriously consider diverting into there but I had no idea whether we would be able to so and as I did not want to start a sequence of events which, if proved impossible to achieve, could contribute to further anxiety among my sickly crew, we continued on. I was confident of the boat and the only real worries I had were with Lynn and Sam and their unhappiness. We ploughed on and things appeared to be improving or perhaps I was just getting used to it all. The waves were now coming over the boat and spraying into the main cabin so I was forced to close the cabin door to keep the interior dry. (Lynn later stated I had done this to prevent her seeing how bad things were, the only thing I thought she could see was the plug hole.) As we came to the Pier Head and alongside the Sea Cat it started to sound its horn at us to allow it out. There was nothing I could do but get past as quickly as possible our only reward being more waves of heroic proportions as it passed us by very close indeed. We proceeded along the dock wall past the old Isle of Man landing stage and soon the Langton came into sight and with it the ferry still in the dock. I had watched the ferry some thirty minutes earlier manoeuvring into the dock in reverse but felt sure it would have cleared by now. I gave the dock a call as I had the sneaking suspicion they would divert us to Gladstone, some half mile nearer the open sea, and this was not something that I wanted to do in the circumstances. As it was they didnt but told me the ferry would be another ten minutes and that we would be joined by the Manchester Challenge8, a three master, sheltering from the deteriorating weather. I could just make her out coming in from the sea and ten minutes later I called Langton again and asked how much longer it would be as circling the dock entrance in this sea was becoming extremely difficult. Lynn must have overheard this and expressed her own brand of opinion, bleep bleep, and demanded they let us in NOW! I tried to explain that they couldnt because of the ferry and received a whole new set of superlatives, loosely translated meaning, that they better had if they know whats good for them. After pirouetting for over half an hour I finally saw the gate sliding open and made straight for the developing gap. Thankfully we reached calmer waters however there was even a three foot swell in the dock. The Manchester Challenge8 entered quite soon behind us and the gate slid to. I could now tie up and survey the damage in the cabin thank goodness for super glue. At this point I made my worst error of judgement as, looking at my quivering wreck of a wife, I said to her See, it wasnt all that bad after all was it? I will leave the rest to your imagination. =Dave Leach and family.8 Dave adds: The organisation of the above was, as I am sure you can appreciate, not as straightforward as it sounds. Listed below are the contacts required to synchronise such a journey. Pomona LockvManchester Ship Canal Marsh Lock (Weaver)DYEllesmere Port Council (swing bridge, Boat Museum) Boat Museum Eastham Gladstone and Langton (Gladstone being the main agent) BW (Stanley flight, swing bridges) PS. No VHF required or Pilot, but desirable Total cost, sum 150 (Langton charged me 35 for dock which included week in Stanley if Id wished)Souvenir Video 8The Ribble Link Trust have commissioned Video Active to record Building the first Canal of its type this Century8. Video Active are to record all events from beginning to end. They will video various stages of the construction along with the opening ceremony. They have now completed their first section of the video which shows the full length of the route before work commences, the next stage will be to record various stages of construction and a cruise along the finished waterway. The Trusts aims are to release three different videos. The first will be a fully edited version of the route and the entire construction. The second video will be a limited edition which will include all archive footage, these will be supplied with a numbered certificate of authenticity. The third will be a comprehensive video comprising of, the Rufford branch, the cruise along both the River Douglas and River Ribble, the Ribble link Navigation and onto the Lancaster Canal. They have also be recorded this years campaign cruise from Tarleton to Preston from aboard Dave Dawsons boat, Bosworth8. The scene at a sunny Preston Marina on Friday afternoon.Suppose Edgar Allan Poe Used a Computer )Once upon a midnight dreary, fingers cramped and vision bleary, System manuals piled high and wasted paper on the floor, Longing for the warmth of bedsheets, still I sat there, doing spreadsheets. Having reached the bottom line, I took a floppy from the drawer, Typing with a steady hand, I then invoked the SAVE command and waited for the disk to store, Only this and nothing more. Deep into the monitor peering, long I sat there wondering, fearing, Doubting, while the disk kept churning, turning yet to churn some more. Save! I said, You cursed mother! Save my data from before! One thing did the phosphors answer, only this and nothing more, Just, Abort, Retry, Ignore? Was this some occult illusion? Some maniacal intrusion? These were choices undesired, ones Id never faced before. Carefully, I weighed the choices as the disk made monstrous noises. The cursor flashed, insistent, waiting, baiting me to type some more. Clearly I must press a key, choosing one and nothing more, From, Abort, Retry, Ignore? With my fingers pale and trembling, Slowly toward the keyboard bending, Longing for a happy ending, hoping all would be restored, Praying for some guarantee, timidly I pressed a key. But on the screen there still persisted, words appearing as before Ghastly grim they blinked and taunted, haunted, as my patience wore, Saying, Abort, Retry, Ignore? I tried to catch the chips off-guard, I pressed again, but twice as hard. I pleaded with the cursed machine; I begged and cried and then I swore. Then I tried in desperation, several random combinations, Still there came the incantation, just as senseless as before. Cursor blinking, mocking, winking, flashing nonsense as before Reading, Abort, Retry, Ignore? There I sat, distraught, exhausted; by my own machine accosted Getting up I turned away an paced across the office floor. And then I saw a dreadful sight: a lightning bolt cut through the night. A gasp of horror overtook me, shook me to my very core. The lightning zapped my previous data, lost and gone forevermore. Not even, Abort, Retry, Ignore?To this day I do not know the place to which lost data goes. What demonic nether world is wrought where data will be stored, Beyond the reach of mortal souls, beyond the ether, in black holes? But sure as theres C, Pascal, Lotus, Microsoft and more, You will one day be left to wander, lost on some Plutonian shore, Pleading, Abort, Retry, Ignore? From the Internet Author Unknown 1999 Campaign Cruise Awards Ribble Link Trophies Best Dressed Narrow BoatKelley LeeqD J Toon Best Dressed Cruiser ^Bracken#John Massey Best Kept EngineFerris McLoed#3J M Howard Best Illuminated BoatnWLauneaLinton Childs Ribble Link Shield For his continuous & tireless efforts in support of the Trustb`Phil Unsworth) sig |`"0`")$"$"$"71 XT71^ <t71 <`71A <71֖ <l71 <71&A <|71N <71v <X71@ <71ƕ <71 <h71@ <P71> < , X\ , (;,, ,eP \+t ,E \+t ,% \+t ,݁ \+t , \+t ,: \+t ,i \+,t , \+,t$ ,eǂ \+t ,E \+t ,%% \+t ,T \+t ,傃 \+tt ,ű \+t , \+t| , \+'t ,e> \+t ,Em \+t ,% \+yt ,˄ \+t , \+t ,( \+Qt ,W \+Zt` , \+\t\ , XH ,5 \+?8 ,2 \+8d ,` \+08p ,] \+08` ,=ҁ \+$"8X , \+6 8` ,/ \+l8 ,er \+8T ,E \+ (8d ,%Ђ \+48X , \+b*8` ,- \+88 pMpC\+g8 p-C\+ [8 p ΃C\+g8 puC+!8 p+C\+8 p5nC\+BC8 pC\+N8 p˄C\+v8 pC\+8 ,== \+<8| ,l \+8h , \+$;8d ,Ʌ \+.8X ,E \+H08l ,%; \+8 ,} \+v/8 ,m \+8` ,Mۆ \+ 8l ,- \+"8P , 9 \+8D ,z ,F=< , XP:X ,5 \+.8 ,1 +T ,` \+T@ ,墁 +<-| ,=ҁ \+\ , \+x(d ,/ \+ ,er \+d ,E \+\ ,%Ђ \+r)l , \+Ε( ,mA \+:D ,Mp \+&` ,- \+U , \+~\ ,u \+XP ,U? \+0 , \+jX , \+X ,}߄ \+ ,m! +h ,P \+P , \+D , \+` ,e݅ \+( , \+X ,N \+T ,} \+\&h ,m \+ , \+T , \+\ ,L \+:L ,u{ \+R ,ݽ \+.l , \+)p ,^ \+;d ,y \+X ,Y \+B` ,9 \+2| , \+] ,\ \+~H ,5 ,r X ,ہ (;* d ,b X$m ,Ղ (;(U ,q \+( ,]G \+( ,It \+(t ,5 \+( ,!΃ \+( , \+( ,' \+( ,T \+( ,с \+(X , \+(D ,ۄ \+(t , \+( ,5 \+(t ,mb \+( ,Y \+( ,E \+( ,1 \+(| , \+_ , C \+( ,o \+( ,ᜆ \+(x ,Ɇ \+( , \+( ,# \+(\ ,P \+(p ,}} \+( ,i \+( ,Uׇ \+( , \+( ,A \+( ,n \+( ,z \+( ,fȄ \+( ,R \+( ,>" \+(p ,*O \+(l ,| \+( , \+( ,Յ \+( , \+( ,/ \+( ,\ \+( , \+( , \+( ,v \+( ,b \+( ,N= \+(| ,:j \+( ,& \+(x ,ć \+( , \+( ,^ \+( , \+( ,q \+( ,] \+( ,I \+( ,5? \+( ,!l \+( , \+(x ,Ł \+( , \+( , \+( ,L \+(x ,y \+( , \+(x ,ӂ \+(l ,m \+(p ,Y- \+( ,EZ \+( ,1 \+(p , \+(| , \+(d , \+(x ,: \+(t ,^ \+(l , \+(t ,q \+(l ,] \+( ,I \+( ,5? \+( ,!l \+( , \+(x ,Ł \+( , \+(t , \+( ,L \+( ,y \+( , \+(h ,ӂ \+(l ,m \+( ,, ,(p ,EZ \+($ ,1 \+(| , \+( , \+ ,w (;X ,d (;xmX ,q \+( ,]ր \+(x ,I \+(h ,50 \+( ,!] \+( , \+(l , \+( , \+( , \+( ,= \+( ,j \+( , \+( ,Ă \+( ,m \+(t ,Y \+(t ,EK \+(X ,1x \+_P ,i ,_P , X$l , (;iX ,eP \+ 84 ,7 ,d , ,n  , ,  , ,,[ ` ,M ,P  ,| ,\  ,w , ,u \+@8| ,U \+18l ,5L \+ 8X ,{ \+L68p ,} \+n28p ,] \+#8l ,= \+8( ,] \+8 , \+P<8| ,΄ \+;8p , \+D8\ ,, \+8 ,o \+"8 , \+((8` ,̅ \+H+8x , \+R8h ,> \+.8t ,l \+8| ,ݛ \+8 ,Eކ \+8T ,% \+8< ,< \+T84 ,m~ \+8 , \+@)8h , \+z8 , X , X , X8l ,5 \+$8X ,2 \+8D ,` \+@)8h ,Տ \+8` , \+.M8 , \+:8X ,/ \+8t ,^ \+8H , \+8` ,%Ђ \+V8T , \+8$ ,mA \+>8 ,Mp \+\8< ,- \+8l , ΃ \+x#8p , \+n8\ ,+ \+<8 ,5n \+t8T , \+&8\ ,˄ \+T)8X , \+8l ,) \+8l ,X \+8\ ,u \+z8h ,U \+bW8 , \+$8 ,' \+58` ,}V \+88X ,] \+v8T ,= \+8T , \+x78x , \+8X ,@ \+:8\ ,o \+8` , \+8l ,}͇ \+^8 ,^ \+ ?8x ,y \+B8h ,Y \+8h ,9 \+ 8x , \+8X ,H \+88t ,w \+DH8 ,A \+:8d ,! \+*8t , \+8` ,F \+n#8X ,u \+N8h , \+8\ ,ӂ \+p8, , \+x78h ,D \+.'8l ,s \+8T , \+ 8h ,iу \+8P ,I \+Z(8h ,)/ \+8h ,^ \+8h ,y \+(8 ,π \+08p , \+8h ,- \+L8\ ,\ \+78h ,a \+8t ,A \++8p ,! \+b8P , \+=8l ,F \+P8h ,Iu + 8d , \+ :8p ,ӂ \+`8X ,a \+8` ,A1 \+8X ,!` \+8d , \+48t ,ὃ \+?8X ,I \+48x ,)/ \+08T ,!^ +*+8p ,y \+8P ,Y \+l8d ,9 \+/8 , \+28 ,[ ,xm=| ,鞁 \+8X ,́ \+V8l , \+8( ,? \+: 8 ,m \+6 8( ,ќ \+L 80 ,˂ \+ 8  , \+T 8 ,q) \+V 8 ,QX \+8 , \+98` ,Ƀ \+80 , XL , +8h ,1 + ,}t \+Z(8p ,] \+28d ,=ҁ \+8d , \+l8p ,/ \+8( ,er \+#8 ,E \+`"8l ,%Ђ \+\8` , \+8d ,- \+$8d ,\ \+z8h ,- \+8T ,̓ +b_8 , \+W , X ,5 \+^) ,2 \+P ) ,` \+n. )0 ,Տ \+ ) , \+d ) , \+؃) ,/ \+ ) ,^ \+< )  , \+ ) , \+ ) ,} \+:Y ) ,] \+z)d ,\ \+DO ) , \+ ) , \+V ) ,e \+dp ) ,E \+ ) ,%G \+4$) , \+\Z ) ,m \+ ) ,M \+ )  ,- \+2 ) , E \+0) ,u \+ ), ,U \+t- )$ ,5 \+c ) , \+X ) ,B \+ ) ,q \+") ,= \+ ) , \+PR ) , \+ )$ ,@ \+I ) ,o \+ )  , \+() ,^ \+u ) ,y \+0 ) ,Y \+ ) ,9 \+x9 ) , \+ ) ,H \+) ,a \+6) ,+ Xg ,w (;ą , \+M  ,u \+x} ,U \+: ,5L \+& , (;hZ\ ,Eȃ \+l , 1 {filename} P{pagenumber} {datetime}-iKZ uh KǖContents_Start('\+p8, , \+x78h ,D \+.'J@@O PP \X4 p@d PPe \X4p@p 0lPq \X4J@@ P \X4 p  PlL A5Jt4tPlL  L nW7r]7n97l`TCyH!̲e+c%M7   0X]7nXX    U @ PP ,^ \+ DD RIPPLES P ,` P-0l@@ P ,y \+ pLtPlL JLL nnW7Lnn97l`zyH!̲bc%M7   0X]7XX    D RIPPLES pP ,` P-0 @@pP ,y \+L 4%PlL A5 $ ttPlL JL nW7r]7n97l`TCyH!̲e+c%M7   0X]7nXX d HH ?s JlP ,H \+?4 ,h } @QU8`.@./'FFtI $  X]7m<iV ,,The cover picture shows PADDYS PRIDE overtaking BOSWORTH as both were heading down the Douglas from Tarleton on the Thursday of this years Cruise., $x<<< - (;, -rP (;|, - (;,l PlL A5JttPlL  L nW7r]7n97l`TCyH!̲e+c%M7   0X]7nXX   U@@@ P ,^ \+ p@RPLES PP ,H \+Jp@ PP ,y \+ptPlL  PHL n 7<Cnn97l`3{yF!̲Abc)M7   0X]7\7XX   @@IPPLESJP }H\+ @@pP }y\+ PlL A5 t ttPlL  LL Xn 7<Cnn97l`3{yF!̲Abc)M7   0X]7\7XX @olume 5 tP$P }EXJXX X=U,u P)nh 9)nj 9)n\[!,_U W63OEK X Tn&!?Y!<Un 49]#{*@ffEn 4Qb' uY %  D CQ zR $; UXhHxaʨg5nW9![ ]I—`2  @X]7_<=U( <UUUTHE NEWS MAGAZINE OF{ rBuilding Britains First Canal This Century pdxd=(((:( W 7C ?\-r U 5;",1+o<^b=n9yr3{m Fx[z \+D( @X]70CDJ NaC[ȊN0n)A|n)B|l.L.`6DɥtI $  X]7]7a$-*JPP]September 1999] P17G\+]\ `lL NiCȊrk0n)A|n)A|l.L.ic6ɥtI $  X]7ia$/* XX^Volume 5 Number 7^^[ PP47w\+3^xE  \ГWSeVZnB9zMC@~`4` xX]7S(dT"   HH   YAM HH  CYAM H  cXYA pHH   YAMJHH  CYAM H  cXYA (H   YAM HH  CYAMHH  cXYA H(H   MJHH  C M H  cX JP$d t  & PlL % LL  ^Widr]7n97l`TCyH%",,e+w^%RtI $    0X]7n '() X@oB@  tt  PlL % L  n^WidKnn97l`zyH%",,bw^%RtI $  0X]7 ()X@oB@  2  J@l GGGlbtscgrtmrosoftplutoesidJDxD  allan 4   tt  PlL % L  ^Widr]7n97l`TCyH%",,e+w^%RtI $   '0X]7n ()#$%&X@oB@*+p , \t  PlL % LL  n^WidKnn97l`zyH%",,bw^%RtI $  50X]7 ()1234X@oB@ 89:7 tt  PlL % L  ^Widr]7n97l`TCyH%",,e+w^%RtI $   C0X]7n ()?@ABX@oB@&@tt  PlL % L  n^WidKnn97l`zyH%",,bw^%RtI $  R0X]7 ()NOPQX@oB@ '() t  PlL % LL  ^Widr]7n97l`TCyH%",,e+w^%RtI $   a0X]7n ()]^_`X@oB@12w3 tt  PlL % L ' n^WidKnn97l`zyH%",,bw^%RtI $  p0X]7 ()lmnoX@oB@ ;<[|= @t   PlL % LL 2 ^Widr]7n97l`TCyH%",,e+w^%RtI $   0X]7n (){|}~X@oB@ t@t )   PlL % L = n^WidKnn97l`zyH%",,bw^%RtI $  0X]7*  ()X@oB@ PQRt)   * PlL % LL* H) ^Widr]7n97l`TCyH%",,e+w^%RtI $   0X]7n  ()X@oB@16 t@t M) PlL % L S n^WidKnn97l`zyH%",,bw^%RtI $  0X]7N* ()X@oB@ 16tMW NPlL % LLN ^M^Widr]7n97l`TCyH%",,e+w^%RtI $   0X]7nX ()X@oB@# ) ttWoMXPlL % LX iWn^WidKnn97l`zyH%",,bw^%RtI $  0X]7pN()X@oB@ [\] @  `a49trmetridtksbabtlawtslaburnoadcrhnoyrggoromwedavidswbseccr|dedgEUXTONeuxtfazaykyguhimodksnudsIIrtIWAjohnssknowsl40casrtoweuigi'syg|m6uf^yray'swsyyrosoftornduxnksnolrORMSKIRKopaylncolutoestugrsnapRCribbdobttsuttTDurstsidvaunivnwWt--DewyyXELFLEXy|sJDDa a49 4bja` TectoxWpPlL %JLLp to^Widr]7n97l`TCyH%",,e+w^%RtI $   0X]7nyX()X@oB@ghi txoyPlL % @xLy xn^WidKnn97l`zyH%",,bw^%RtI $  0X]7p()X@oB@ qrhs ttxPlL % L@L ^Widr]7n97l`TCyH%",,e+w^%RtI $   0X]7ny()X@oB@T l1_Plain% X5 U d<^b=n9yr StDnAbl){< u %ee+  @@C?<<D l,l1_Plain2% lT1_Plain1% T;W R^MmnA6X kcRnA6J^W8^Mm"nA6X kcRnA6 (A3E8^Mm"nA6X kcRnA6JPxW R^MmnA6X kcRnA6 W 8^Mm"nA6X kcRnA6J(PW R^MmnA6X kcRnA6 W 8^Mm"nA6X kcRnA6(PW R^MmnA6X kcRnA6 @@ W 8^Mm"nA6X kcRnA6 W R^MmnA6X kcRnA6 ('X 8^Mm"nA6X kcRnA6 (2X R^MmnA6X kcRnA6P=*X 8^Mm"nA6X kcRnA6 (H  iRwFrn9o9{@q;bҞ<!7   X]7900 hh000PBuilding Britains First Canal This Centuryild P BD -ھP  $Y.ܔ61l  <  ". )h) "J"I   X]7r1 6MEMBERSHIP APPLICATION FORM + The aims of the Trust are  1.uTo promote the Ribble Link - the connecting link between the Lancaster Canal and the River Ribble and the country-wide network of inland waterways.  2.uTo promote the fullest use of this waterway by all forms of water borne traffic and for all forms of water related commercial, local, tourist and recreational activities for public benefit.  3.uTo promote the education of the public in the history and use of the canals and waterways and of this waterway in particular. + + Name ....................................................................................................................... Address .................................................................................................................... ........................................................................................... Post Code .................... Telephone No. ............................... Club (if applicable) ......................................... Type of Membership required ............................................... Amount ................ Annual FeesIndividual 8.00MFamily 10.00 5 Year MembershipIndividual 36.00RMFamily 45.00 Life MembershipIndividual 96.00 +Please return this form with a cheque or postal order to: Chris Gulley Membership Secretary Oro Negro High Street Mawdesley ORMSKIRK L40 3TD? D,}6 DqG\++ DQv\+p+h D1\++ DԀ\+3 lpBh\+   D1\+ xpB`h\+  hpBh\+  @ Dq\+ hpBQh\+  D1\++ DK\++ Dy\+<+ DѨ\+ + Dׂ\+r+ D\+ + Dq5\+x+ DQd\++ D1\++ Dƒ\++ D\++ D\++ DN\+ D}\+ Dq\+ DQۄ\+ D1 \+V3+ D9\++ Dg\++4 Dі\+J+T DŅ\+Բ+0 D\++0 Dq#\++( DQR\+:`+T DLL  n^WidKnn97l`zyH%",,bw^%RtI $  d0X]7h()`abcX@oB@ ghi  $Y 8^Mm"nA6X kcRnA6x``w+ -+Ѻ:`$U)k Pps I7|ZP|8hd7   X]7s,hͷx+y+&<R* ``x+&&&+Sponsors of the Ribble Link TrustponsorJxxy+<<< (G\++4 ('@\+U+ (o\+ +HJXX, -ѺW*# HL HM9bpM* , QB? (,   DrawDraw     l  B      35 `* 35"`*@353`*F`* ]  `*"`*"5 5F6F535,S5E8$@f#3*-2 2<-<3* # <<  !3,2: :23,<&! &85W"@?"8"D5VK5W"VP""Hh?", X5{$@b3fmpfu fu<p<m ff b<]<] b]MVMV ]cou| |uo<&c &]|5̙"@̙"|"|NN55N̙N̙"5"@5533 f f33NN""5ͼ5 `*@ͼ`*`*  5ͼ5ͼ`*tBUB oYMW]g| - -,{`)l_n2tvL. cfHD X]7Q--0(̄ hh-000Tel: 01772 313331 Fax: 01772 627868?dd-((( @ 4bX @I 4kh  - w+-`)Cvl89CP`"`.@.tI $  X]7w0F--6P3 tt-;;;Reedfield Place Walton Summit PRESTON PR5 6AB ?x-PPP A 4|P AI 4*8 A. 4  An 4p0 A </a49ABacdipcniliquetlmettprcugetmetridtksuctdyguebabtlawtsibdldBMIFboadostownridgew|rbuBWscrrrhnoirkyrggor`mmodoi>guectuquatubiavlrasomweubiliaraburesdapibrtlwbseccr|dkignsimolcuiseECgwdgtastiifd>ln-suimratossttiuodxtfacilucibzaykyelr>ugiatriaceglauhrdrimodksnudsymaeosiaculnIIimpdtnceptosrdtpsIWAjcggohnsstokl40aciancasrttctmroydibogulatalgoobtmweuctigi'syg|m61agnasuadanuf^yray'saurwsyyticrosoftorndstlyuxrbinecqueibhsslnmystravoluamncodiolrrciORMSKIRKneopaye}quehetralncol]ratutoertatsueiPR5pra}ttimouglvrququersnapRCrddfldhcRIBBLEribbdgbysobtdewetutrsagtpncerquempociosquudtwtsouscippdtabhcirtTDllmpwfldhurstcidtqu}trtiqueurpukcptridrnatviunehulalnatstibulivranolutpatulput|wtWt--Dewyisyyx9XELFLEX hh/DDDa49BHegestastlowequisque44/$// x0 0* Ym}k'3]i,QHW+Q\؊s. *QHR"QX]7I00!{S dd0***Life Members ? PP0 + H0  e< $0 0YINNFʀ?@XZ @XZ`.@.RkS*+tI $  X]7^Fe00 w|D <<0qqqMr H F Knowles qMqr R Blackburn Mr K Hudson Mr C G Stokes Mr R T Blane Mrs D F Blane Mr J Young qMr C Fazackerley qMr C Gulley Mrs R Yates Mr A Yates Mr D J Davidson Mrs I Wall Mr H Wainwright Mr R W Forshaw Mr J T Nestor Mrs C Nestor Mr J Staziker Mrs I Staziker Mr J B Butcher Mr J A Carr Mrs M Carr Mr D Leach Mr R Nicholl Mr P Williamson Dr P F Wrigley Mrs P F Wrigley Mr D N Jackson Mr R F James Mr M R Henstock Mr H C Mayor Mr P Lang Mrs P Lang Mr N L Walling Mr T Tomlinson Mr R Leeming Mr D Morrison qRev G R Richensq Mr C H Bagot Mrs S E Bagot Mr J D Southworth Mr R I Womersley Dr E Ellis Mr J D Massey Mr G Nickson Miss E Sibbert Mrs L Simpson Mr K G Green Mr P Tomlinson Mr R Bowling Mr D McKee pDr A Padfield Dr G T Whitfield Dr``0$$$~ 7Ŏql~uB 7Wq\~~ 7Oq0~ 7S`q8~+ 7sEq4~0 7]q8~Ol 7 q,~ᧁ 7qT~s 7t+q@~ 7zq0~Z 7q,~) 79q@~т 7q,~M  7q@~H 7Cq<~q 7wKq8~ 7?q4~ 79q8~'7 7Mq<~r 7lq<~K 7q0~ 7Lq,~o% 7 q,~a 7]=q4~ 7q@~%؅ 7eq<~ 7q@B~ 7q<B~uB 7Fq4B~~ 7q@B~ 7fq4B~+ 7?q(B~0 7q,B~Ol 7xq<B~ᧁ 7q<B~s 7Zq4B~ 7sq8B~Z 7Fq`B~) 7Vq4B~т 72Tq8B~M  7qHB~H 7qDB~q 7q,B~ 7cq8B~ 76Uq4B~'7 7Wq<B~r 7jq8B~K 7Wq4B~ 7q<B~o% 7Rq4B~a 7;q,B~L4<8pHB~|Յ4 pD (@u2 \*XnvW'nOWya[Ac=m X]7'NOX X A3 ~W']<òpnWX~719|\^;Qwx7   X]7ChB3C3 (8Az DDB3 ? ?01257 dC3((( GP\+? '@P\+? 0,6!8xxCv>RNa]pNm|xCv>RNa]pNm|xCv>RNa]pNm|xCv>RNa]pNm| -6 WnWb.nOWy[A؈cۻm X]7b'%&.8TTW6 ` VDrawArcDraw ` Vܱ` Vıscan_image%*<<????????????????????????0~0~0xxAxAox`` LJ`?a>?>?<80 ??? ????????????????????????????????????????????????????????????????????????????????????????????x??????????????????????~??????????????? ????????????????????8?????????????8??????????????????????????????????????0???????????????????????0??????????????????????????????????????????????????????????????????????????????<???????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????p????~???|~?~ ?~???0~?8~>>~~~~a~a|?@`` p0pp???x????????p??JMX7nsbabtoadriraodefdeuxtfgrahhkeiIWAjassmlcasriasmahewsnowr[spstmoveyeribbRLTruffdttwhlty DD7 allen447%77 0>abbout>ssrgetlstksbabtrrowfdoadtritriunornyBWcrhrraggodaveidswsefdDIYTPe-mailuxtfazaytgnowlarahuhkeudsIIrtIWAjassmcggohns'sslcasriasowemaccsfldrahewsrnksowr[spaypdulslrastmoveyepodibbRLTrobttuffdrifsuttelimrsukvivnwthltWRGy|sen DD > abbott4!>d >>D,XD  &~5drn 49]n 49],#Zfh,H,%o 6qq RES J E '*e^!(tn)A|tP7a kcD]iPtI $  X]7XEE5 ppE55BVolume 5 Number 7 SeptemberB 1999C PEA>w(;"B @N ~Wo&]$=(KB}vBvt~CtI $  +X]7^NNx:K N??Editor: John Clegg, 25 The Farthings, Astley Village, CHORLEY, PR7 1TP Tel: 01257 271198 E-mail: jclegg@argonet.co.uk ?Fax: by arrangement - phone me first.t.Nxxxc8\+g?@c5\+?0cc\+7?cؒ\+z%?Lc\+T?tc\+43?(pHR  Q2| T WW͸,_W9)?n[A@l.L.#\WtI $ TX]7oTT< |T?For the most up to date information about the Trust and for articles from the previous editions of Ripples visit the World Wide Web Site at: http://www.?argonet.co.uk/users/jclegg/rlthome.html? xT<<< -G \+~?l -'@ \+ ? -o \+`?arthJ(lTi1_Plain%JlT HS7!/ AmVfT*TgTZ^0 X]7qTT( XTrSEPTEMBERg o99Ad(dT(((D{-rH^60=pFo0 \*T kfk X;W ju)aRp[KMXY@X.8.\B?cptI $  X]7jFm''@nju)aRo[@KMXY@@. ._B@dptI $  ^WX]73m'qr-y X N2@ju)aRp[KMXY@X.8.\B?cptI $  ;WX]7jFm'% tx*X u2=@nju)aRo[@KMXY@@. ._B@dptI $  ^WX]73m'- sliquetnslstksuguebabtrrowfdoadtritriunornyBWcrhrraggodaveidswsefdDIYTPe-mailuxtfazaytgnowlarahuhkeudsIIrtIWAjassmohns'sslcasriasnkwdowemaccsfldrahewsrnksowr[szpaypdulslrastmoveyepodRIBBLEribbRLTrobttuffddrifsuttimrsvivnwthltWRGy|s DD3Y abbott444Yf3Y2Y @@s_rJDDt_ chris 4u_t_s_JHthhPlL % LLh hh^Widr]7n97l`TCyH%",,e+w^%RtI $   v0X]7n ()rstuXoBy hhhR^MmnA6X kcRnA6 (h hhju)aRp[KMXY@X.8.\B?cptI $  ;WX]7jFm'wx HTh ihRWB>o!:lwRZwZ\Dz`.@.`FktI $  iX]79hhd 44h?Published by the Ribble Link Trust Ltd. Printed by Lynbrook Reprographic 15a Boxer Place, Moss Side Industrial Estate, Leyland, PRESTON PR5 3QL with assistance from Lynprint Unit 3, Coppull Enterprise Centre, Mill Lane, Coppull, CHORLEY PR7 5AN+I hddd -J \+I? -*@ \+? - o \+l? -Ꝁ \+ܳ?x -̀ \+ ?@ `liT1_Plain%Ti mh{3oX,6!OMX)ZY[qB)h)DBnI   X]7,6!ii @@i?Pi -HL\+? \44m iOCOC)Z/N^r@P D 8 X]7mmm` @@m?mJPm /Hb\+? HHm  ^rhuatksbotritriridgew|rcrstfldhrggdaveidsDTPe-mailuxtfazayguhudsrtIWAjohns'sslcasrLCCikwdowemarnkspaylrobtdetsuttvivnWRGy|s P0Du atkins 44u1uuu  =Q@@DrawDraw =Q@(Homerton.BoldHomerton.Medium X?=Q@ <;Q42PRINK @@=QPKK<STRUST Ltd.8=_@KK;`THE<=(`J4 RIBB EPR/ JwwwwwwB P JPR/R/uu JP Jpv XkW̟\7nOWya[A,c=m X]7\7efnX v @X~qoWȟnOWya[Ac>m X]7 opxX ,8{  N6bSc;VxР+vyVB͞B{:N><<e$H=D a4j|1(h* sz#)m<+z l/  \\}777botri'sdeuxtpribbs DxD} bennett 4}}} Dc~atksbotri'strirdgw|rcryhrggdaveeELWYeuxtfazayguhudsIWAjohnskKJlcasrgLCClkwdowemaMcKmrnkspayhillstribbobttsSMsutgeswvivnwhltWhtak-Hwdwilksy|s DDd~ atkinsx4e~=d~c~ DX Tz/L>/L/LLk߇Sb׹ ~  2hȖ? JPP&)))hecastcoIWAJ D' harecas l4('& dd)???atksbabtrgu'shlkwdrobtt DhD* atkins 4+*)JP:X;x a%b a a666ABabgavnyrsliilrmastswprrgetstytksbabtssstokeBCNbirislaburnoadtri'strirdgew|ruucrrltrrhnwddtCHORLEYraggiftveoatbridgeldaveidsDHdwdyDMdudyemeELWYemmet'sn-suuxtfairhurstulkrzayt'sawxtulwdgGEOprojectsgystouhecastrycotmltpudsnflat&sweIWAjassmcggnohnskrsyetKJknoswsl40casrgLCCyldlfnaLMloweynbrkm612gtsnsawsyMcKmeuikldrrnrowboat sthoksov|lolrOL14RMSKIRKozpayPBCpdbulowysldPR257pstmovetsyeQLrrsfldRIBBLEribbswRLTrlobtdytsSAILINGSLFORDropptbourSJ772045MsnahtazikrraummeymdstTDlhTODMORDENtgeyTPukn-navig&swvivnwsltrfolkelplhlthntakilkslisavWRGwrigywwy|sJ(P,,,a666llang 44|` """"981S"8R2K" 9Ut"~i"S 9aÞ]"xxSl]i"Ams"*o;""JWqo"`oAmh$ń"PٲSS+"&cCG""">xX""dml[Tq""|%"!hϥݽ""B "B"V"F @H]" qJO"2HvCk"6/":";O "J"d0zh"L"`;Y"e&Z_"?Rp3T"d    eD   % ~  eD eDJHH e9 %99 C ' $$'C9~9%9HpH $> Hd$$$pstribb h De preston 44fedk W=WDFu`w>}*H&UT AX]70/08P LΪa666ABabgavnyrsliilrmastsprrgetstytksbabtssstokeBCNbirislaburnoadtri'strirdgew|ruucrrltrrhnwddtCHORLEYraggiftveoatbridgeldaveidsDHdwdyDMdudyemeELWYemmet'sn-suuxtfairhurstulkrzayt'sawxtulwdgGEOprojectsgystouhecastycotmltpudsnflat&sweIWAjassmcggnohnskrsyetKJknoswsl40casrgLCCyldlfnaLMloweynbrkm612gettsnsawsyMBcKmeuikldrrnrowboatsthoksovolrOL14RMSKIRKozpayPBCpdbulmowysldPR257pstmovetsyeQLrrsfldRIBBLEribbswRLTrlobtdytsSAILINGSLFORDropptbourSJ772045MsnahtazikrraummeymdstTDlhTODMORDENtgeyTPukn-navig&swvivnwsltrfolkelplhlthntakilkslisavWRGwrigywwy|s PPϪ,,,a666jlang 44ЪϪΪ \ڪ777cft'sirwekrsylowyty$xD۪ c 44ܪ۪ڪ,~  WDrawDraw W X?%3LB KK%,X3DX̴fiwLD6L6eT3UfGTiXv̸̘%X3f6|fTX6̘%3%3XB3U!%c̄33KtW?B w fzlWXN3%wJ|\ u2~qBWL4nOWy[APpcm2 X]71CDMK | 7"+|APx QvNNTEvq56N> ~6EnZq#"$.hB71t>8^FXd~5~JT Xq1BZ==NnBZyDl.L.cȭfpitI $  X]7zJ#GRAND OPENING AND INAUGURAL CRUISEfh '' %+P%+%SEPTEMBER 2000%%   IF YOU ARE INTERESTED IN JOINING OR HELPING THE TRUST, PLEASE CONTACT THE FOLLOWING :-?ING :-  b"@n #\ "@n#h z"02'4 ""?Ӂ% c"02 "02 ^"02 6"028 qLWJxxn#U|=ze kc,n7T| tI $ 6X]7zD/ {{{ A grand opening and an inaugural cruise is now being planned. We hope this will take place in September 2000 with boats joining us from all across the country to cruise the Ribble Link Navigation The first canal of its type to be built his century. Up-to-date information is available on the Internet at :- http://www.argonet.co.uk/users/jclegg/rlthome.html   L8 0 (;$ 0c (; 0 (; 0J (;x4 07 (;  0q (;ƃ 0ʾ (; 0 (;( 0*Y (;0 0z P; 0 li1_Plain%  nyREz0j+*\uD ) [|4yd X]7oQbv2 bbbMEMBERSHIP SECRETARY Chris Gulley Oro Negro High Street Mawdesley ORMSKIRK L40 3TD?S d4 QB -d Q"<- Qk-f4 Q♀-0 QȀ-|0 Q-:( Q&-*kdd 8lo1_Plain%  9yTEzJj+*\uD t) [|4yd X]7!Qs sssCRUISE ORGANISER Frank Parker 20 Greystock Avenue Fulwood, PRESTON PR2 9QL &01772 717367? T@ RB -T R"<- Rk-r4 R♀-kP RȀ-$ R-ȹ  R&-R  RbU- d|abborslseAPCOaprtksbBNFLboadryrirab'scmycdgew|rw|rainugswBWcrrh{eeildsraggo-opr`lct&sdavepdekDHdwdyDMdruedELWYemsfairhurstulkrzayrnigawgGBglayeuhbtstoimtwdudsIIIiIWAjassmohnJSjudylkehysKJlcasrgLCCyldLMlosiudhairweynbrkmpsnsaudldMcKLeodmeui?tMK4mmyrnrowboatyldthoksovolNWorEpaylPBCpmrmoveyerrslRLTrobtdyygstselbySMsmytazikrveuymdstbsphTime'n'TatgelawyswvivnwhtakilkslisWRGwrigyy|sJPP,,,abbotteWlang 4 | p7 $ס8<,yEV~z:eA 0uO@I(L$y ](*LJLP H QtRIzVbOJpf$N( vbVJiGLFBD-EDR2nQ x20DJ4T/}="JhCgpH@BH XX222abborslstsprttksbaurst'silstBNFLboadryrirab'scdymycdgew|rw|rainugswBWbw'scrrh{eeildsraggo-opr`lct&sdavepdekDHdwdyxDMdruedELWYemswafairhurstulkrzayrnigawrktgGBgibslayeuhbtstoimtwdudsIIIiIWAizjassm~ohnJSjudylkehysKJlgLCCyldlgoosLMlosiuweynbrkmpsnsaudldMBCcKLeodmeuryi?tMK4mmyrnrowboatyldthoksovolNWopaylPBCpmrmoveyerrslRLTrobtdyygstselbykidgeSMsmytazikrveuymdstbspwfldhTime'n'Tatgelawywizzel's-navig&swvivnwhtakilkslisWRGwrigyy|s PP,,,abbottclang 4d< l$ WYn{NFTIYnW@yDA("L. cm^D ,]7gkh]}.h^ TTAltys   Association of Cruising Enthusiasts Association of Waterways Cruising Clubs Babtie Group  BNFL  Bridgewater Boat Club  British Waterways Board Cleanaway   Clive Hurt   English Tourist Board ELWY  Enterprise plc Grampian Pharmaceuticals  Halifax Building Society  Inland Waterways Association  Jacksons   James Mayor & Co Boatyard Lancaster Canal Boat Club  Lancaster Canal Trust  Lancaster City Council  Lancashire County Council  North Cheshire Cruising Club  North West Tourist Board Preston Borough Council  Preston & South Ribble Partnership Preston Marina  Prizemove   W Pye   Ribble Cruising Club South Ribble Borough Council  Upper Avon Navigation Trust Virgin North West  Wheelton Boat Club ssoc L  p>4l pN^>4p p>4X pV>4d p>4h p^f>4,!| p&>4L p>4L pI>4` p~>4 h pF>4!l p->4X px>4l p>4< pf>4`  p.\>4| p>48A p>40d쾂q>4h쾂qN^>4< 쾂q>4|쾂q>4쾂qA>4`쾂qn>4O쾂q6>4d쾂q$>4d쾂qp>4\쾂q>4,0쾂q>4@t쾂q@>4Xh쾂q^>4X쾂q&>4~d쾂q#>4Y쾂qo>40 p쾂q~>4T}쾂qF>4 @Be DxDC dee 4DCB H  [qBX'H' HHv  ){'|' HH  ){X'H' H [ĜX'H' p X0 '& ~XZunL nG nfq+, XZ  !,]CDV? ȐȐ  6`8xDrawDraw 6`8 X?6`8 l6`8@686``868hu:]8 `&Lj@,@`alg6&h3)Sh@#g hLfh&Yksigla`qsw@ ryu3 uswst t qsqr3 rɀsSN@31*S9ӂ =@C`[J&%ƆSsYsss3  tC@&F&s&s3@ SF-9& F+bvY $!"S&#,%`-.:S) ;1F23 3s/ .&*s`+f9+s)(s)&(s%s% #s!s`sLsLH&s$L&f,fsss sFFf2s`&SD fs`sss &&sSS  s4@F 3L; @    3 s sss3  tA j.@ B30 s  sY/@Ss Y/ s3 @DXH@@DSJ3fP&KXsH W@@U ;T'T3`Vs&SsFOssF@Do 3X@0@ E 3X ,OYKE:@SHL7@9IH@ISH&Jl,K&.L7SK&!K#9IY/O@7FS9ys==y@NӄPC9ZfPY/247Us39Z&Z@SVs3 Vs33Vs3Us3Vf>W@&XEXE WGSVGYw\:SVs3SVY/ ZZ@@W7ZL@Z [SVKfZp \CVY/V1W5@W7Wg2 ZZ@&Xs3L[fdFUGWFVsXZZ `YMY=U,.&Xs3SVY/:ZS\@&X7ZHYJXS\FXFX WPSVKFZfo\IWY/W1X5&X7gWe7YZ@X7s\sh VLWVYZYfZH&Y:X2sY;X7Y/O@7FS9ys==FO PC9ZfPY/247Y/O@7FS9ys==FO PC9ZfPY/247gWe7YZ@X7s\sh VLWVYZYfZH&Y:X2sY;X7gWe7YZ@X7s\sh VLWVYZYfZH&Y:X2sY;X7tF;I&T@F;FGF,KG&TIBIEF;Y/O@7FS9ys==FO PC9ZfPY/247Y/O@7FS9ys==FO PC9ZfPY/247gWe7YZ@X7s\sh VLWVYZYfZH&Y:X2sY;X7gWe7YZ@X7s\sh VLWVYZYfZH&Y:X2sY;X7Y/O@7FS9ys==FO PC9ZfPY/247ٟ?P@F?9`S^St3s{ٟFٟٟ̩f,   S`so9`S`GF??@]@F??S??ia@N&@ ?F?D;VS@?RLl\difot,Y,SS & @ٛp@[uL&`@Y9 `Fӣ3Ls@sF,lff`Y_ӯ@X9LYE&T9SU UU@U nS,@S@ @YS&1-B`qSoo`mILFFlp&SL` Ls  SL3Fyy&Ssn ӳv,L_LY1]F]Sٰ`hf`ss,y?;`S@Efe3F;;l;?gWe7YZ@X7s\sh VLWVYZYfZH&Y:X2sY;X7Y/O@G K`OC9ZfPY/ 9L:= L?=GX&BX@&Cw :&Ct&;C)?L@;CS;Cy;C&;Cy>W BC;C&;?@?M@=C> G>sF@?I=LK<I&;C>sUBM<?<lB<A<C`<C<C=C[;OB@?qQ@=CS>E>G@?IS>I9< <lH<@L >S?Q?P:<=CgWe7YZ@X7s\sh VLWVYZYfZH&Y:X2sY;X7gWe7YZ@X7s\sh VLWVYZYfZH&Y:X2sY;X7gWe7YZ@X7s\sh VLWVYZYfZH&Y:X2sY;X7tSJLY@SKyZ Z3XsJISKgWe7YZ@X7s\sh VLWVYZYfZH&Y:X2sY;X7gWe7YZ@X7s\sh VLWVYZYfZH&Y:X2sY;X7SVY/fZS\@SV&T [f [LJ&XY/SYF=YDfZN@Z&RLYZXS\FXFX WPSVKSVNSVlQSV&TV6fZOZ@X7Ys<YZ3HfZNZ fTR3WWSZ\Z O Yl9X2sY:X7ٷYRv@9&TS_ fٷt v z`p&aK9&TSVY/fZZ@Y3XyX3XWZSV&T [f [LJ&XY/SYF=YDfZNZOZNY3X9V@YS\t} 3 ӡfS3L sL9fF  l CYS\:3X3@ CS\?y>lv:L<L<= =ƙ@<:ӡF<=::L:::`: :<s<Y(?,@s1f@S3@,=A,= B> B3?&=g&B>=f><&<3F<s: > I3D"`EDE3C C>>.3@3:,&:@*:`.:s29>F>>S@cAcCd`De@DeC@iBksAl@B@FSGJSEsI%C+`<S4S@`:l:::S<&F=YSS;3k9<|F<`y::Ӊ::<y<S<y<L<:s<`<&=&=>???@YDPG KLN`&P YQ Q9R V 3]Y[S+3Z4W@ UI UfV9U\UfXrXu Zf&[f[`\L]S`paj&ilstSpLn3m@sjsj7Sfyebs`3s^YS&T,Q~LRlzRsFO9P MjFGyL`DL?SAl: :ٜf;@<S9sFLLSRSKzI7F LGCSB@fB3A@3&=&=@@<@<:S::3:"=7E`r:&hFALSfQ,;Qs8Q9Q7Q`4Q5Q3NS#`PFRTWXL Y&Y Y &Z Z Z@Of XYgYYZYZlF[l`YdFgdl_S]S[s[SYY sY 9Y 9Y*YG9Ys_[se[f\i`sxfpia@jTjMkF^w̶{Y@{s. mSoqYs uyz yfxxS{L{Y~S?xfDw[vYr&gpL~nلllSkkƃygycy&hag[gL^gVY_lN&[{ UVVlnX3 Z,FSYLN`oyHP IGISBJ,:J`3J,J%F3f>l :!:`$:#:%:s(: ':)<,<0<2A @A9DL&BXY=R@<F><F>S;F>:F>:J:V:c<l^3<^&=&gC,v<,y: S=A:F:::Y:::s<s3>S?y>9=:: ::3#>AGGO,QFTFVYZymfouz z}F|&}ӂ lx`+x.x,xs/x32x0x3s3&ƈ393``0yf03SFY3F3 ƈӴ WsFs Ӗ` Ӗ ӖYF&l3ٝhL̛3ys@sYslssӠ&3@ VF &3SwSsddӘwL9cV&pSPƈ!sSs&&9{l]ovӑ9 sƐ v9MfSTYaSn$s`S@l٫YLS s`@6ӯ7sS*sfSووYFs| ٷ  f,f3LYf@LY,|qSL=y4sSOO9F9`rf@M[yYC`YCٻS+̻..(y'$9Yl ``aSZ Sw SZ3L=sY̸  &eSI&L`S3`LLYDyL5 59+ƍ̍ Sf9fL@q3~lO>  F}Sz vfsluYtxYWfzR|_&iYs 3s3`w ffZS7.`S Ӂsu v gh^y`.3`0_:^,=Z9VlVV`WWzUpVqUl`QmFQoNdMSoMfqLtLwL3vLxL{LSzL}OفLOs|YNE9DS9F3XD3XYDSY CS\TS\6N@S\msvs l&fsS@3Sf 9L~tgL zsh@dS\@,f`4ӡ@@,h-&}L.f/ӡ&001LY3ơ4Y`4t2,ry1LkF1x31~2Fs1L90&f0lx/p.&c,3g@,hTjlo@lnYsp ry̩L3|jlto۝@Sp l|F̚S`3jSpp/kS@pstL3vx3wvvyxS`xx FS `` xyY}SsS3YrFqq&p3isip@ l@@p v9sӆ} 33 LrSd@p1Qp\,@@WpV,PYQQS &TW`Y \, [`S[FZZs\}ZwXq@Wpft!r@jtygf3e &h,imYm@m j`SjjlYm9q usn vymv3llvjtjt=tL@Ct4FLsG,SKFyK&yK&LӶFLKGG`CttF @Y x x9 xxS ssFtt v9 xS vL suY xtP{T@P PFPsPWƍSTnP }@Y}YS,&3Y,FFFS`Ll3SƮ ӭl Yf fL&fq&`L}Y};w|@@;}<@=??>=SSBxS?};}:x{=ӡ@: :3<:ӡ@=Yy>3S;@<`<ӃL<?pS<l|: SE}H@SE3 FYFH3G FӉSE}SESESE3M~ "z@` S3 &!#L v` U \,@[3ZSZ[3 ZWU&XZ\$[@[ ZFZFZFfZFZ*ZY$\,\\S\ f\S \[3t3L/Y@&L@333Y9ӫF&Ls9@@S&y3F&%3f535s79(#&@`&t BZD,@ B B̡ B B,EfD B"ٷy@l̰s@Ӷٷ 9@9@sf@& t:&=@:,:S9&=< s;ٝ:,<7&@,ly&f,%X@[@9Y@Wƿ X`SXYXyYZ Z9Yf^sZ9Y@BYZ f@KY9BE`BFFI.OsK f`RV&[TY@AV8fW`8VVQsKY;> @;l`;lL;3;9<F<Y> >s=;lX @9pbKه@|x, rqr@ryqY o n yjs _cgsEm Sqr@YtZyxQu9| :DL~J~Y&TXهYه&;Es3Y`3tyc@ӑYy3SlӑVW\@XSS^[FZZY YfZXtC&E@`D& DDCG,FE`D& @&9Yf&Y  &&\}@S>3=H50&5 Xf.F03;`lY3,d m&~Ӂ@f `sS`f3&fbf3 SFS@Y  S 3 sL 3Sf   lY  F  F s3F 3m3q s} ssm&il&SqSq- f@@@`@SFF9 Ӷfs,s@GY]f`v&vS̺F3Fl@ &v&RU,Xffhj J LS&@. s SpZW333` ,3f 3SF ,;S}"x lӌ`LLfS&lYSLSY,9&s&f`3f fy#>DYdWF, yY `SR C 3y Szq  ff,@!T@6Fsf3&Ʋ,Y3iF"Ss,,@&s3`Yk`cgD1 z So rffzus~ &$S$$s$3,5s=@:&7@C;^ <W;US<R<U<W=^=^> a>c3M C<@30ƶS-SS+3 !lZS3`4s_ 8SCsg@D2D/fE/F`,9ED3 ED``CSHSHf HlG&IJLx SW̶\[ټYٺVLXXӠZf[ [@\L\s\\وWR&hyW&hXdW dX d9W1LT\\\\ [&[\[SS[&XXYYS[,S[L[\Y[[Y,YFzZ,v\r\e`\YU@\ P\L\sH\=[A[s>ZA@YWXYo@Wf`XsXSVsSsTُ&S3R3FR3Q3NL`HFH&`HLGHHwyKtMRJIl^FfqFcISZIVLI@VJ@VJO3JLJELG<BSSHH`RPSP<IFP9OVS]YsJYsKYMYTZQ3[O\L\A\6\+ZYl\L\ \\ZZY\\\\ZZs\\ّ\3\s\\\`XtS[LmS[HY[H[D[BZl?Z@<Y8@Z3`[0\F*\'\(\,&\s#\$\"[%yZ'YF*SX3&X:&XJsYfZYU@Wl_STM̋HwSK 9ISSC>;;|F=&r<`xs=c:c9`7LY?-+S@8`<;fB 3BA@ASfBSBSSCSLDӾLEfFS E,E  E>&@|&@SFAJBA@D9C&CFCS@BFB@D3&A @?&>>S>3s @̳@Ӳs Y Sl̳t]c.@9^[, i&3`_ ^9^FӮ3@`FF33Ӯ`̬Ft`B@3 `&ӡ&÷Kcz@s= 7dtFuzpA3(3s+3*3,,BqYES6&8,*s+(f3s@  L  Ss$@SƂ sFs$  ӃSS`S Sj@3@S3  @ @ 9173@32191 Y3 4 734 F53 fW@SƷ f,&+Ʒ)( :3QfVX UO3I9Ƹ 7Ӻ3,@FSSt!@ SL  f t4?@y`W5L'L I@3@S@l&02YEN Oy,[&,bisnF{  Sfzufeyp `l9 &3l3Sy f&lffS3y 3#&F*"#f 33sXn3l~sqS&s{syFfyٜs ft b3O;.S`3S fLrSLrSr}F3sYk3lg@RSa`r3&93ft[>s& Fs3t&@`B 5@&@`@@ 7F@ >B(`AY`A&@` a@$3F8Ias L3( ` s#$sM)@9@s,s0s5s99,8L95$٭)s,)&Y@0@;LU\ S&Y9=0py2,? @9,/5=u5z96l34r2zS2{2 2 34@ :39,f9`8 <9;:S:99f7s735s4 9` :~<=?@@< :9,@`7di@b9a?_sTy`aa rc`ccW dsMSdFCd9fc@7c7b9tGZN>\Y@S[@AX@A[3X\YY\Jy]6S[@AYE]@YE3I93EMMSO]3?SJYEtD#bZ@YE[!d#lI!D BYEtK5YE8 f@L5YEF5^5^8 f6LT96sJL5YEtSXlIZ%X@YlISYL YMSXM[] [ZYlIN@9Q`s,yLr`3y&SF`a3dYymLfay^YlWf,H9Qt/}Sa1z@S0U.sg.hS0z0k2JS0UfYb@LYsfy33@ l``lf|3n y33 ̩iYfL`̦ l3kYiS]LYtpB]Cfv@B]@BlyBoCfvD3` D&`B]Y@]v{lY@[\]\c_}@\ fZs\ }Y^}^}S``o_ f9_aS]e\ fF.dJ‚@H fGjLGlFfvFxGSSHJLZH f3k+3@3nӥss,33L@fvfwyz̩ mh3ntƸ0zF@ƸzF@3wƸzBzL@EzEzsEzSEzEl~E FGSCBfAsGH`HFFLsJfIEz @S l9f  `zSVd@V&U3@VLWY[&`d@_[ӆVXL/R@LfƸLt5:!@Y9`7S2`F8y<9Y9`XHKKz@HF`K̷L HF@?3A̷@?`?,??̷BSB@?3`???`oXu@Spp&pooLo3o`wvSpӑ3@Y F`LL& FӑLf#̡YϢܧ@٤sS,&  L W(@%9#&" "$S&S&'&(Ƶ@'s&`%8Z}@Ӈff93s&y}s3 ƁFss~@z~lY sFllfd@&`S`S̿&tzB@&L&@&8s}3@}S}} }f}`}S}L}s}&s}~,F&ssL3&  Ӄss }Stg5@̛ƛ`@̛&Y̛y @  Ly s   3s &  t39L@3S5639L9943Jwe@l `ibas_1l+bBbNbYR3cS[LhURT&SSTlDTCV:i3LPsYNzLEGQsyP3NSQQQQSfVX&\l]]S_&%ZfLZ&ZSYX`S^`cdglhhhLhsjfuffu`3mL]3k_@_`Eb8ycY9LeAeYDg Bh3>j,<&i1h/Fg-gshYfedSdc,cbsb&3dlelekF9qƞFnnfoqlbYd]SkBk;kY9l6qo`nfPuFuBu>u:q,?r<rF*r'r(r,&rs#r$r"h"qu v3uv vlvw3www tstFsLpolllSl X Q 9T!@Q 9NGXQ :G(@:L:f:!:,& ;(y=f&=&SA'SDs+G,&E<3:Lp *l@"L!&!LLL,,-3"YNS&3dY'i(q)`h*a)E)L?)s%"LPRL[^&S@@TL@T4QR&STsDT3AV:s]eF@TL9Y^F*@9YL9YL9]9^y\ZL@YF*_a@YL9YL@W@f39D N@@W@W  S ` L`ftL] _@_ ^^L]f` 9`_ t9 |,&@f Sl9,& f̈f X .s00 @ .sy/82 .sk.w0|!@. f.F."S0/)/. f//0L0&/L. tsO @  3sS   o7:O@8"@8"S8!8"S6+7Y:8B8Y;848 .9F88D8O9F:>:4S;Y"f88" "M@S,&Y`<S^&Y&Y|s@g@]ZOPQ@&S3`O !@ "l#l'S,&tf?,&E=@?`.EQG.f?,&?(?+?`.+@,YEr>@C`.yCM='FA@5A 8DCYE;F32@@'C`.t7`.u9B@7`.7,;7s<@8B9.:37`.YJ-\`@S[`.Z1Zl4Y8^ P`X3i\`\x]"S[`.`\/`a>@_s29^s2L]s2`\s2 ^9Y_<`a>`aF,`l._s2X/s2M@s2f3@s2s 1 @6:IORYF[`[,\sӎfz^&R` 6ts2K vE@ys2&s2Ss2s2S sY9ys2`.I F@Y 6 QS @s2 TE`. 0@ 4Y 6/0U ^D@F s2 s_S&s `= D& G ,=L 5,F s2H4Msa@L6J@fJCHFfJSKZyMsa LOO,L6u3K G@:3 @sTS L8s & J fE9 3>39: D>HL@FBBR D@\DLEEf F, FlEoHoIX I`PG>G?9GAFB UF [g@VF V&OVJ UOYWl\XSa [gYI9ZKVFtCy^@JƼgcyJ&D>JF>@FSsR@e@lӄss3iYWsFIFt!J%h@Y!JY  py"j%c#FT "JY!Jt`\J`5V@L]J]O\R`\3UL`fWaVL]JtHƸpd@@Jy@nYkƸJ9,HSG@Jt)J,i@)O)X)a)i.[-@)OmJr d@mOokp@jrOoVp,ULnJ nsLmMmO}Mg@}&S}Y}`}gyaL\O~N~K}&SO[@O SQLY@[ӻ\OfSeFZOtO\g@&SZF`g^LG&S:S[w@S[Sb&d iYmy p s eSrwsiaS[ddS@kpzuf,vtYpXkg$@g v`s9 "S$!YlgZik&@ kSsz@~Ysӓ& & @qc k6}9F@7363667L88F&: :i73k6s}h1@x`xӶuqpk,k,kljfPof(9tLxls}s{zsx` ZӠ@`ُl ӠsfF̑`tUPX@TssRsQyPN&aTsT`XY@sUsY &X̓&XFZY`T`TTTsTs UssUstHq M@H@HlHK MN Ht9@9@tΥf@yff3l,@,Y9SF3,8`A@SS3SsYS7L|?@&;:9 77S7,73 =<``@+fF+9PjyKSA F&;y`@s}F|`{y}S~ ys}XЬ@`@ystL[\@S[@[S[\\Y]S[ &@ &'y@l*`L0y37f93;6s@s[3|F&eT 6's9nQ.`NS33&SL  &xF)@& S, & Ns|={:yS(x'x'yM9zQ{Lby~3a~LcYSi~ x}9{xSy@z3{xs|} `sF)S نF` &3&YLsy,Y SlӁS fyƃ jSW2 #ss f39l&lv&@F3Y Ls$l KS [^)@TTLS@SSl`T,8 Ys! [YY3SXTtyf#@ӮƬ̪ y33LIFӮt + @lY  S$0W(@.3.S. .+S*s%%$$l3'l(+#/l-0). 11.<]@    s9 F*F lH  G fF sJ N` R VnAS)  :; @::S:=:L]:ly:;<`zF;3uS;3ks;Z<:ٷFt@F s-5f=ٷYD sJ(,&F/sf*@L3y8f.f3 @f$3#! tn3 #@3&Y# #&ys3t{/F#@{L{(L}"F#F } {Lt9LP!@LLL9L٣ +9!L93L6$@ `̤L9L)+ 3   `930%@`'9L(/3̣`930%@`@!'9L(/3̣`930%@`@!'9L(/3̣`(~@LfF83<@>y=3@@Pp v3&} e`L,<@ ` @*3L*f,<f,<)l` `93H%@9ss(`,30ӣ#9L999sty@y`yyy3y`5'4>}@6'6'S6'36'F6EL6`b5}7FxS<p=`@ LY7*6'tZ4]\ e@[4Z,G@ZlN [ e[SN]@9[4S@8yHz@@8`@>@AS@lHYEu`BӓyH\E@8F8@8m8cvw@fo8nAm3Q mZlam3dn3hnsmn~foq@ukubLxDfr>fo8t\Gى@lH`vnى&3a3?lH Fى@ lHI̩]ىӧ3~̪e9SD C lHXlHefb@lHLlHlHBYD\@XLYRZHKBXTSGY EF)H3FG *GIJIJ3IISZFSZFXFnN?P@9InHٗG@KSY@WYX nY@O\=\S\\LYVZQYsJYD`YYDXYDX GXIXLtN `l@PF[ P`Ms MPٷP3m@ٷT3fg3i3m]f@a\KsQٷTL?d@Ts_LuLSP&SV@]@HT IITQY@yMTFLV&LV3KZL&dMiMsN~K,KىJ SM&KH`GsyMYyM3K3K 9PUZyMTyMTIPo@sT sFr3mjk&is&isa&T&R&SS&P P QsTt΢8Vye@LX`f`ny^TTLX B`F@ B&iSClDF3mCv Dw B` Bc Blf B&it@:f9fu@@&i@nyYr9fu9Y_yLg@&it&i@@&i`F@{SoSl&iXk#@3m3Ə }fussf&}3z̋n3m@hn@m3m e@y3m@ &if v e sgSjy3mRwW@RyR3|RxR{T@TfWVluVuRytE}yK@E}&G@I̠yKI&GE}Fv@@ӗSFىsY`@SP3ىSHj@&;;L:F:lF: : :6, &(@@$ӧ/%%ٞ$F$%%S%ٸf%#L`#&"l3"F & 3` & !"#$s$s%S%$$F0O))b5s:C&CLCSSHFFD y@?@&;ى&;&;L&;t: <@S;@:;; =3f;fS; @Ss 3 , `s `S -5@f/.@. -@/F3ƲL5L370Sf/s@  @  ӣssS   L`@ ٝ`&L3Ll, nQ@`3ysf fS&  f`33@s@,3&` st@Ul@@3l3@@ӶsfӶ:Ds1@?`< ;:s13<F"fHDl&CFBA@3??SSW$@SSSS@SSSSSSSSSSٻSUWWW̵ TSSTL]Y~OC@9^9^Y9^9^@^@`@`L_s^YL]ch #m=rIzCY~!Svn3kjsisiYi g fL9e d`d,d`a `39^fov@oooforYtYvsut3oS@`ӭf SL qs @3ffyy& s 3s &  s 8@Y3s@& A`,G3FfSYhS\A =&S9s  Y0Yp@l&s&3& &S+a @Ff3 Y@YLf@S3%3&nnnSGs K3s  `%!F) `3slL`Y lYL@3S`fSLYLSL {@`l3LYYY+33TYg9p9 {3-M3%3@ 9EmI @GF3FE F FFGKG<2@`33,3,Ӽ`y))`-Gs @l` #@  3S!!S.3 f sf Ӽy@ӼٽSyY&ӼAD@`D3B ACY&CAAFED`D3t   #@Y  2 3&  S  S Y  L3%@3LLLLL S3%@& 3Ly3 &@yL -Y : f f f fL 0Y Y 3 lyL@s1@Ss@s1 s1ٻ! Sste/ Sks1@e f+yg-Sks1hefe t<A-@@?s=f<<`-L@/SD`@?tZ[iaj@L]S[,FSYfd_jb7b5L]L!Yw;@3!!!L! H?Y !S!F!3!tʊ#ӌ@V@F)ي3<Ӊ@Vӌ@V̌lJlF)L!өB@3%ƦlBL@L3%LQGө!S"3#3%t`s1 wG@ss1 ,EJ EY6@5ss1t7W-8L@y85 7_8FH8`- 8Y-8S,y85ts=ySZ@&=`DJsSZ3N9 C&=t9W@&=Ya_999&={Ai@A~E}LM{fflps`sQJA1G`4j@2@V1Z1^1bS23b3 b3a33`&3la2bS3iF3i`4j&4VS4 42@VU {@&@V cfn` {nFd@VӰsT3T&@VE!lX%j@F"SZ SZY!WY!j"g#@e%b&$3V#WF"SZtjZnf@jbLkdlsfnf9l YSkVjbXl^Xft@fol^ol^Fol^nl^n`gnjnvp3Sp,SpFsFr`tSxyxxFxxxfxs3x w3wf`xx$v/w3vsp pkjSjfgfSggsfssf+e2e 9e@:]`AX3lS_{d SFgft`jSmLklklYLl`T@lW@lOd Fs +9v3=vBv?vsGLy .}O32S3}l9 ZSwrysYYrs sjSqb3qsbfol^l^ o@l^ƨ̂3c@_^Ӧ^ƥs^l^l^@̳l^Ӳ}F&S3 L y3& Fs3Yٕ &sg̳l^tY^3@Ybmx3q&lRYbtS>d\@Dj@S>bS>shCi@DjA]@@fVS>bT̛?` @Ơb @̛ssylS3sӤS9`̬03LӸ@3ӱ&Ls9s٭L&&FtXƠbtm@ n 3fc nӑzp:@3vwƓwySz|ӑ FfLӟsS9 SyƘFqfk3vrv@ {FS`sv,x9y {t< S@,@< < F@,S@,9@s3?< y p@{ zszy3yyyL}S3F{ }@  3  yFF fL̈&f Yzƕ{ 1 >ѵ@= S;83 5s4Y0u@2ӊS4/ٮ957@;,`=?? = L91S@%L" F&"#S&L3(f*+L/91s,f)%LK+U@MӟLӟLӟLӟK٩ L3Ks@Q\ӫMsM@@MSMӟ&X&]@S[ӟYZ3fY&X`YZ[YsYSY[,\\\]SS[ӟt,p@,yS,SSaV1@TFTYUSSWV@TYTTӱTFtfY @fYӠ 9S١YfY8s@sLL,3 ,-1Sp&sx&w33ƗY  su[SfEy3SA̛sYsL@LF`S@s L:g=@::<S;SS=&=S<=S=`==&s<:<aNK@=s= <F<s`?&(A CS FF`(I 9SKuO@M`N`YN3YN&IBf=N9*@ffss&` *S`99SSf]%d @`a9^]Y] 9_a ceFd`a@&Ff`fFfs&fosl@q&p`p,foFpqfslsSsq&tY9>@Y9@`;< >&S<f:lY9@<lSi@@;LV39ƀFK ?`SFG`LYyNsLX`5QLQ29QL3N 9NKLOIM7@GKfPOOMJSJ&GEsE`G@D"C@DBCl@l@ @@S"@S&"3 ,SSsS3S,2D@@,,.3..&s,3,s"s+,6.LJ0@CS5`2&0@,t s 6@ %sFMs$s  2@ه3S,.~ /12y22sه3 43@L \3``L)Ƶ$9LySLsG2@s3ysyPf @ s3XfC@ fY|f ft2037@2sL2 %S2,279522sYs@7@Ys40@7slYYst[3@(03F3Ff6@ӆL8 1" ;9,D9fY sڠ3@"sf' 3.33s#`+sӞ3 "tBrG@"L>FYF@9Y'3"t`!ZG@"& >^.d"u:~!@x@:":19j:ft`;y? x?x?lq=p@<Fn=slL?`j@&hs?&OY>:"#N$X'O@%&S$4#?#OS$N&N&K@(E&%&I3,ML@M,;fKHKGJs@H:JQKKLFM`%M,;L]7aO@]7Y]sA]@EL]O_fHy`YDa,;_7_7]7F?3_@F?LHS_NSG3O3> ?F?sGM@9O sUS_ dLsu w9L@  `      G `F`s3`ٷ٬  L L9 , s3 | u_3fY9sG9&J9L9OtKGt@SOsrKMNSOZO`"n@9OO`@ci`r sk`,hTfS9OO#g@ O9 QRS m!Ym#W3"RS"P OhpSvx@sS`s,VsfZr[r@[rYrS noSqnux9v [fv\sSP u@Sy{S `_motFDS SSp@SY&` 3lnSpSp&QSSt2S9و@2S2  59و983`7Z2S;O&@Cn@<S:SyY=p&@_3=_&>e=O<PS<sR<StsRYVو@sR[SoTs|VوU3mFVlRsR[+|Yu@[f]s^&_sF3|sL}Y|z3~   Lه93s` Ӎf3 `ӈs_3SYf[ن]nfnYkR[tY̵i@[Y[9[[ӵ~P[X[}"Uh@["t$a[tyx[\z@yx_Ly3{Ɔ y[xf]xs^yx_`]ySp@3_Lc`F_`Spƥmjy&h \\3_t$\hbu@y`3l]n Yw^uaFtd@ay`3ltҽSps@SpSsٺsF~SprPq}@Fft3lo ``}ftppFft|@C@|Y 3@@YƷs`y@LsY| |y @||33Ӛy   }|GyM@`II9IH F@H,yMYyMsLM`I!e@&وL3@ F,SSY3S 9 r&وtƄa@ SӘƄs3+*ΆS<@S+و &4ly8,9S<S<Y;653/fS+وQӵ@ Fӵ̭Sf ,)+ӵ@))(F+ӵS))f* *&)̏) Z Yf"@a _\ Z^bYfseپd`dٷ&fsea yO@3 ƳyyyFyfYӾ@y3 tS@S39&S3T\ @S[sY33Y@W`VfSXL9WSV3UUsSXY,XS XWٷ&Y̽\\\S9]S[sYY@3S9ӑFӒlY @SSӅf<5, S*@9@<DGFFIK`JMM LYY̜QJ>.@ 3s4&ts@F@L3teY @flY ӧsS@sӲ3̲@s@@sss`s'<@% 3Y!s1S&<L(3) %% (S@%%%l% 'f&'S('%t@,3,ƚ,t<@L,,SS   !L,{TF/W3@TFYTfT U3U3V3V3WW3TFtu@s3@F9&@F3FF:FX@:l ;3<f<;S;:=`=,? f>>"=D?DBDBD`EUE X9F3LL3QSS P&NM@P'XfWY@X~XzWqNqEs<H FfED3?3 >:F:::ltly}@Ӽlyl3Ӽlt3(s@3Lss3tH@S33t39@7 6 53f89<7F @FSL FFSFFt @SySl  9 SSa@ffls fsftL]_3@L]]^_3_sS^L]S@S Y& s@SI~Q@NSM9KFI  K K3 LOsTLNNlN&NtxW~@x ys|*~Y@zxƈ@ نS 3  ƈfs @ k,1,Q@,&F-+.,,Q- J`1Y:1L12 `.,&[ j2J@&h3esaL\XleFh h#Si)j`,jf i&h &h&h&h3SS l]@F S ,9L!L9 3)Ss0y6 ?s l]&C F SX-@yfF0LC/@Y l y3 9*LJ  O\@YTM,@O z`RXyUKfZ KYfYه\\}y\H[AZ7X9SY(YL_[f@ZZYR.@L   &l. G4B3@?<)y9$4L(`::&:R=|y<s};S|;3=f|?}@i:&EH?F] ;hQ@` _ _ _ `l^]f\&^3` asNSc@aB`3`1S```"a( `1y`6`S:c<c>9cL@bF@bD@e;i@3g`g, dYbbFc,3c a`a` @J ES*@`D3CB!@S*SB3*C )D@&DFF`DtQ Ws0@VSTYSSQs0R+`Z VGI<@GFH$If5I<I"I#GGGLGn<@sYS&" % &SS* .0f419/`,16<7"Y&FF A@fFs0G@ @!fL}So@ "9#L3$37,I ^FpF{`[SS&K,CLL8@L0SL(!  tS V,2@SV U@!SY!&S3$fR)YBSV X &hX0@ L(S3> L(4Ϡa@Ơ<SA\asU@PƠ46y<Ơ<@@U@@SBfCDMsP@U&@A@tIX@ILSMWƒbII3@sI 9fL` fٞӱӱ F@s9epwه Ʋf` ,`Y`ƨ`DslӸw,SӠsY mY S . 3&3319`+Y@3fLSSZFSWfYR`sl}ƃffSskYZsIt#CH'Z@F'I & K$ M# O'n )BF'I[L\t@@\,Q\@^[fk \x \sy\\f\\:@\,QW9q@fYY3_\q@ong3[ RfYYwa| z@LzaxeYxhwoywswstw z&ywz,v|u |d{ bLzapaMh@ac^SssYFs9 Lٛ`S,SFSS @3L  fFwaXeb}@eӃzeefAx@eShdgyrlqS~lweX3dPAy@3e@`Y3emiTvk@ni@n&lppq3q&ofs9vLws&{sxqs`p nnitӑ[l@ӑm Sٕ̋,}̔`fӑmq@& zfYls&S 3Y9ƥ3qӗLt w& zv&~Y@&~ӂfy Y`~&~t6Pf,Y @sUfSSPs@PSO`sUftU W@fWV٤`VƶUFVWfWdB@S&&S`F@s@|S@sf 33y3`Ӷ3&Ys&&sFYӦ ٛLss{K@&~{`{{slF&'#;@---&.,S,s)3'9)*@,&.3 2Y9 :f7737Y7s7S79f;:S998@7F3y39L1`. /y0 91`0S0̹//0S030Y/Y-SpL v@tٞSs3qٟSpLssuuwtٞ A@ &3 &f`& tF1 @@flFFF@& `FylF@f`fF L&tN>B@>=3>SB`As&BL> @y3Y s   `ƫft(.@,%*../ ,RY@RR`RRR RRYT̯YVs&XW`WW\ƭ@WR̳@9Lٵ, 3ӷ̳SYL0Z[@SF 3L@SssSђӗ@&3ӖFst6@LsSSsSs3y s Lthk@&hLgk`+k`jil&hSB6@Lf`Y`@933 @ 3/@9Gy8,3Yf%+@8f3<E N R W 3\s a b d@kYy F S f L  ,sS3 L'>`3-$y3fBF2 &  #F))39.$43)F:l-@7 1F0/4Ɨ8L=91?3?&&@, BC@F &FFE+ASA3D2sF3H@*LI"YK J,`J"9I&9I3sJs1Q7FR3T&SYRyQYsO`OYOPFLMsL MK3JFK̝yJHFHs9F >3:f3P7S*5&0 %,3),D *@Q&a`"UL" 6S"S @s3LfFL@9yf@Ơ& sfsY@fs3Ơ&tT&s@&Sss@3&@@@  33lSS@@@XyMlP@yMlYQ QsyMltSkSm@Sk mSpYSkSSk SkSkkm@ll&mFm lSjsnmmL@jllyP\֖@FRQQFyP STS LZs \JZ4Z ;\%&\\ X WWV T sTFRLw!@ ~!y&Y )@`*ff #)&(y&S$$f`A5AD"@A B`CC!LD,(FD@DD,SBsA W `sF@[3 SZLZ"W)Y <yY>`\sFY"\`3 ^ ]3 [3  32@3 l42ƃ0@ f 3 t~3 cC@S3 LL SsCS3 t;3 BR@@3 <1f9,&S>RB <fC3 @3 /4%@2fL1@0/%323"2"4%945f2fts;@,IF;2*('!!s:!DR@>!=186@<S@Y<YG<lJ<R>KA WDLB:@+>!,%J@%%233;Fs5FJs96%t1%3sF@2%1!1 12sFF4374,2% %&Z@Ӯ)9O H&Z`M8%s&(Ӯ)y'C@3)`**+F-1yF>:;S-5I`B -"3)t k-9#`B@!-!49!s; `BS$5`#*!-t6['\J@S[) [:9[@\J\:Y]S[)t[`F`o@SsFus|`ZCsFSsFt[J3ac@9^Js]R\Z[c_]Ld&Z9^JyPJU^@FRJQJQJyPJR _YRbUZSRRLFRJFJLه@FRLG^`Gd`GlsHIه`Lه M^ L@VFJF@MFPFRRƃ@Z f|9lyƃ`xLsvSo3SomLml@ks@k\@ZRlU,XZZ"~@^FjYLkls̾, |Z`\]^Zq@&ccacsFdfbeLS}n&Z&]&Y`&ct0&]n8@1^Y-,F>@6FnF4`` 4Y1^:w`@@:c: r: :<F>}@w>e=S[:cT` ls@chmls k@fj &g@^S^c`@c snfulsFS&3F| sFj e]3 bc bl+,@ c y  y ,"y!& $f&Y(Ƙ*SY*&+SfS+c+`(yf't%sk#h c@^fW@K&gLkLjLLm9J&:3FCPJ fWQN,@MSoMrNzFOMdNg3K^SKfaKdK&gL]^`@]&g]ls]]Y_L_``3m_ nL]^s]fa]d]&gt~r6ه@ls3z ه@w3olsXlsH@lslsXlsH@lslsXlsH@lslsX{q$}@{y {{XlsH@lslsXlsH@lslsXlsH@lslsXlsH@lslstSwdW@UwyTF{3QTLWLX{UwX{q$}@{y {{X{q$}@{y {{XlsH@lslsXlsH@lslsXlsH@lsls`I{M̞@KJӇJ`I3fJK L̞sNYN|Kbz@}xYu&pl3plpFrYlS3k٧edb df3hY h gfFg nYn u&yFLwu tFqFs,t vlxyS|}S ٴ s F{~xY}~}X{q$}@{y {{X{q$}@{y {{X{q$}@{y {{XlsH@lslsXlsH@lslsX{q$}@{y {{X{q$}@{y {{X{q$}@{y {{X{q$}@{y {{XlsH@lslsX{q$}@{y {{X{q$}@{y {{ه@S&ه `~SLYs@LLLLLLLLƒ, ӣYsYyӛ@3L@H@CBfA@AAAAAAC3I yHLsHFFEӛfDlF3Ct BӴ@3S9 Ӵ̟s30W@L  s@ٴ3 L5L@?F@&;L3:@9 8L765Ӵ48SY9F9s8,y8 :<ٿ@?=<&;L`'@`F`ssss, F`` ,@`ls  ,F`?syKS@@DsB3AL?fCF`GSIfJyK@ I IyKJHSH F,SH@D@Ds7`~@S3 Ls3&3fLY ``̦tӮ@Ӯ@S`S Ӯ #Ӵ1@)Ӵ)&+)&&@'s$$&$&$ #s(*L+F+,L-Y900s2&*Y)ٴ)ӴHNY@J JsIHYJYLYNYMLMٸJt@,@slSY,f@ &@ff,LSsFt0,2@1,Y1 102F331,Y@ s̉fsS3 3SFs9 ӌS st  @sF   SsY.l@S3lSYSSS:?@::::<F>l? =<: IYY3@ONF3L33JNY"3Ql RLSVfWWW,V3X33Z3XSXlV,yUfSlQOOs @  `s&sfOsS@@&PP3sQQP,PsO@Q3QQRSSS RsQL&Ps&P&&P&Pt@ٷs&S  Sٷs @f&s@  q@LYL,3  swi@vtYv,wv3t sSuSxv[M&P@3N&K NPP OPFOfO3N&S3#@Fllll 3#  3 SFlw?&aF3@@D C3 A @>?l69A3C0sI@DK7W3@TQ%&K&L3O3SS3V3yWFyW Ty5@ sf3 30f3Y; %  3@`!F $ 3&s&s$(31Ss1 3ss^̳8@s̭f0Ӯ3`Gs̳L s|&ƈ3@&L'  )},|s/|32|0|33مs2ƈL'yL'L'SL' &L'&L'(5@Ӗ`+ `+ ,+Y+`/l.. /.`//23833&'Ӗ`+)L'93@S+`++s.*s/)s/)32)0)3@/343939s/9`+9L'6)3,)1L'/*-`+S+`+8omlo1_Plain%IH7###a494brsAGMasdergetstksbabtncroftlapoirirastdgew|rt-w|rsBWclonfrrhtrrlke'seggolmpveah'srosbyd`vsvee-w|doeDHdwyDMdrdELWYfairhurstulkrzayce9mbyawgaieofferahuh'mstosfdsilblbep_snylaketmltpudsIIiIWAiwpsjasmvohns'skdirbylakeldngLCMCTr-ymLMlouwewrgymmnbrkmpsnsaMBCmcmaileuryiklrsnMRBnrowboatthoksg|volNWorgurwldpawlyPBCprs'shilta-poiqunsfrrsibbRLTrobtdetsgushawcroftkegSMsoupttdgezikratfduymdslwfldodmnuknswvigursvnwsnhtakilksliswhtWRGwrnawigywwy|sz PP8,,,a494fTjohnJH4987 > XnvW'nOWya[Aܹc=m X]7'9:B XH  =<(,, p Lkaysbubrwdgystoiloud-hairPR2QLrogspmsailsTCCClhrupplawnybuoywkdrme DDl aylesbu44mlk lo+1_Plain%  Tb W'_W9)m[Al.L.pNmf tI $  X]7c< 44?The opinions expressed in this publication may not be those of the Editor or of the ?Ribble Link Trust. ?Whilst every effort is made to ensure the accuracy of information, liability cannot be accepted for any errors or omissions.??? x<<< -G \+,? -'@ \+@?t -o \+? -  \2555AEdyudyAWCCaysbuBCNbuftBMIFWc-h-davakCDroursdedefletgystoGU29hboufldiIWAPSlLCCloud-hairmsnMcAlpmhaelMIDHURSTozpayPR2SptQLrdpmtsailskegutmacblspTCCCasplhrupplawnyvspspuknbuoyWA16wkd DD3 AE444C32J, mhƨՔ1{W vL. UEtI $  0MX]7p. ,,,,[,Humberside ?10am?Sunday 7th November Carlton Towers, Snaith, Goole. Adults 2.50 Children free Free parking Enquiries: Compass Events 01803 835915el/F 7!Q,'(;,7!Qt'\+?7!Q}'\+\?`7!Q]Ҁ'\+8m? 7!Q='\+?l7!Q0'\+?47!Q^'\+?l7!Qݍ'\+P ?47!Q $ w`8# `W ..КtI $  X]7^" ^^],Boat Jumbles The events listed here are all approved by the Boat Jumble Association. The organisers of these events have undertaken to conduct themselves in accordance with the recommendations in the Boat Jumble Associations Code of Practice. These are designed to promote the interests of the public, the exhibitors and the organisers, by encouraging high standards of organisation and value for money. Come to the events for all your boating bargains, new and second-hand inflatables and boats, chandlery, buoyancy aids, quality clothing. All at discount prices, engines, fenders, rope and rigging from specialised chandlers, fittings, and accessories. Come along and join us for a really great day out for all the family, or better still have a marine car boot and sell your unwanted gear. Refreshments and toilets are available at every event.  g?(;,D gy^?\+[ gY?\+xt gπ?\+ g?\+ g-?\+] ga\?\+z8 gA?\+j g!?\+W g?\+ g?\+8 gF?\+Nk g)?\+4B g ?\+k g?\+^ g?\+>8 gD?\+,@ gs?\+| gi?\+H4 g?\+U g?\+n5 gB?\+ gqq?\+\Q gQ?\+@onduL WNWȟ\7nOWya[A c>m X]7\7$X tyAEdyudyAWCCaysbuBCNbnyswdBMIFNc-h-davakCDroldnDHMe-mailEA'seELWYfairfldletgrahGU29hboufldiIWPSjeffkeppellLCCldsaysayoud-hairmsnMBCcAlpmeuhaelMIDHURSTNBnovozpaymoetPSptrdpmtsSK6skegutmacblspsplhrupplawnyvspspuknbuoyvWA16wkd-cwhtakilksJDxDz AE 4{[zyJlD RIPPLES JPP ,` P-0 @pP,P ,y \+ H  =<++ dl+01_Plain% DN D0?<͉M0? kc͉$L0? (HH-bC<,,, H/hC<,,, pH  YAM++ HH !YAX7++pH cXYA++ (TH  YAM++ HH !YAX7++HH cXYA++H(H  [A<,,, H  [A6<,,,PT0Q\ kgk pfZgpJ|``  0 JHH/ T, D {eeRLTx D chantel 44%  JEILDDrawDraw JEILHomerton.BoldJEIL EILLineTool EIL 9H A45yy!v!yy_8 _8_8_45˿s}s}"˿"!"!s˿sl94H A^ _8^ y$y$_8^ _8p,9tH Ah"U"Uh"h"f_8_8:f:U:Uy<y<_8f_8֝9H AM"<"<M"M"F_8 _8 :F:<:<yy_8F_89vH A_8yfyf99_8_8h9 H Ax_8xyy++""_8x_8EIL Ar h!=r:%%*Ek-EU=k<X-~b QU &N&c 1B8585I!/z)t)/;r?2@/[#L4 sfMr;AD ;MAUUUA45yy!v!yy_8 _8_8_45˿s}s}"˿"!"!s˿slE-AUUUA^ _8^ y$y$_8^ _83AUUUAh"U"Uh"h"f_8_8:f:U:Uy<y<_8f_8VYAUUUAM"<"<M"M"F_8 _8 :F:<:<yy_8F_81FoAUUUA_8yfyf99_8_8(pAUUUAx_8xyy++""_8x_8%ADUUUAr h!=r:%%*Ek-EU=k<X-~b QU &N&c 1B8585I!/z)t)/;r?2@/[#L4 sfMrE:= 99A45yy!v!yy_8 _8_8_45˿s}s}"˿"!"!s˿sl 9%9A^ _8^ y$y$_8^ _8p;9t9Ah"U"Uh"h"f_8_8:f:U:Uy<y<_8f_8֬9 9AM"<"<M"M"F_8 _8 :F:<:<yy_8F_89g9A_8yfyf99_8_8w9 9Ax_8xyy++""_8x_8E:=Ar h!=r:%%*Ek-EU=k<X-~b QU &N&c 1B8585I!/z)t)/;r?2@/[#L4 sfMr<JkGP8sF RIBBLE X ?W+DW&DW$/em/d/ t ) ц  0WW,Jhht  m#n#DrawDraw m#n# X? m#n#@0LM :{&U9vBK9N LfG:@Ql A_K\39@7G 1,8Q9T9=,nC3/9)Z&AS[,@@WD9s>fTMYWNW@oBh0@:73<Fy0@Es@7:`W,@3 xS\̑bL_L`33L@U[PSI9ooM`s,5Nha2j4]9hsV8@}9_`D,yPs9R m9 \ArYqntYL^  `l} yaF xRYSk AvS;vQpU|g d&k`haLZL hU`hYQc# dK jKPse`up`O`OmoP^lslv,[Lml@v;hP pfUef9Sf9S B&Sk ,h,l 9 SJeo {S3L f\`c@Fƣ@&& S y9N Q@n LwxSsf&NlL|`,lS@@`y(@6s=V&Ya ƌ  &,qƌs̝V@QY?  -l* }syƆFY{9 y Y u`bGG̅-S~ t&ِ@zzSYl3j@[9L1`(9$,,y _  W*3``Y@Szz3 sF`LTs0ٙ3@әslyVYuB 7  `̑}3[sr?@:Ln9u9 SY`3@;5,9Gy)L?$G9DQ@:WM[`L`9@[VQl>@.LS?^0`;f]sF``]]s]sS{3s3S{ H{  0WWp,`,PHH8  0, , H:$=(0, , p(h@ vXnW-nOWy)[A nOWX]7 YZdj W dn.GZv1hn[WOnn[WOn`.@.n[WOntI $ X]7XYC('JXPPPThe Trust is supported by:d (in alphabetical order)  ? ddY(((%:-X%Ҫ-\+nE%d Wn[5Zn)Ky2n9`.@.n)KtI $ X]7sefp(@eppp ! !S!upport by a financial donation.а  !!Support through Landfill Tax scheme.? PPf GN7\+y  HHJZ0, , H  nE0, ,JpxH]  |130, , HH^ |130, ,J(p_ailsrgetstyAWCCbakternsyBNFLboadurnyBWBcrstfdlidahh{eeCHORLEYcaorodsircyveDETRwsbue-maildELWY-sufldgdystoGUhHCShebbtmltpijassmcggimkehmnowsl40bLCCggsocatym61awsyovolNWORMSKIRKozpksPR27prmovetyeQLrdfldlostsavielbyvuTDlhodmnTPtug-o-w|ruknfdrlw|rbWCwbeww DD` aire 44ad`_ H  {0, , DDH  [A@0, , HH K 0, , HH4K0, , H  0, ,JpfneBCNbtrebhoycltorveldavew}DMfdsdykeghrpIIjulkl]rtaepsdanrowboatetwholdbupks-gdtfdipsrfdheilaimpsowbytuttaylsuwhxymrwdJDxD alf 4.HtH N0, , HB N0, , H  ZA++ HH  =++J H.7!7!O0, , ll0+61_Plain%Ll60A1_Plain1%P@vnDZBb~p͉M0? kc̉$L0?Jl(lA61_Plain% I XWOw\7 nOWy<[AT-nPWŸX]7\7yzdHde  YA^0, , HHe >=YA0, , HHi  [Ai0, , j[[[ailfneulukAWCCbakternsyBCNbtreridgw|rbhornyyBWBc&tlrltondrrboatmarvelstfdlidahh{eeorodsircyvee-w|drw}wsbuDMe-maildELWYviroflddsdykevegrdGUhrHCShebbptmltpiIIjimulnkehml]rtabLCCggspsdaocatynbrknprtmzMBCmrnrowboatetwhvolNWoldbuzPBCpnsrkstldtre-gdtfdipvboatRLTrostsrfdvielbyheilaimpsowbyvututiylshodmnug-o-w|rukrlwebshtakbekweb5wwxymrwd8PPk,,,aireCkendal 4lkj|$l AZA  ZAZ HHA }N+L  JEILDrawDraw JEILHomerton.Bold X?JEIL EILLineTool EIL 9H A45yy!v!yy_8 _8_8_45˿s}s}"˿"!"!s˿sl94H A^ _8^ y$y$_8^ _8p,9tH Ah"U"Uh"h"f_8_8:f:U:Uy<y<_8f_8֝9H AM"<"<M"M"F_8 _8 :F:<:<yy_8F_89vH A_8yfyf99_8_8h9 H Ax_8xyy++""_8x_8EIL Ar h!=r:%%*Ek-EU=k<X-~b QU &N&c 1B8585I!/z)t)/;r?2@/[#L4 sfMr;AD ;MAUUUA45yy!v!yy_8 _8_8_45˿s}s}"˿"!"!s˿slE-AUUUA^ _8^ y$y$_8^ _83AUUUAh"U"Uh"h"f_8_8:f:U:Uy<y<_8f_8VYAUUUAM"<"<M"M"F_8 _8 :F:<:<yy_8F_81FoAUUUA_8yfyf99_8_8(pAUUUAx_8xyy++""_8x_8%ADUUUAr h!=r:%%*Ek-EU=k<X-~b QU &N&c 1B8585I!/z)t)/;r?2@/[#L4 sfMrE:= 99A45yy!v!yy_8 _8_8_45˿s}s}"˿"!"!s˿sl 9%9A^ _8^ y$y$_8^ _8p;9t9Ah"U"Uh"h"f_8_8:f:U:Uy<y<_8f_8֬9 9AM"<"<M"M"F_8 _8 :F:<:<yy_8F_89g9A_8yfyf99_8_8w9 9Ax_8xyy++""_8x_8E:=Ar h!=r:%%*Ek-EU=k<X-~b QU &N&c 1B8585I!/z)t)/;r?2@/[#L4 sfMr<JkGP8sF RIBBLEJ)D RIPPLESJPP ,_ P-0 @JptLP ,$ P- llA 1_Plain1% hh---Ripples 57 - September 1999yowla P @c P-\ HH  YAM,, HH !YAX7,,pH cXYAmT,,Jl 71p71ЬkLЬkLp71p HH71Ь4f, ll 71l71kLkLl71l H714_, LDl 71 71l2l2 71  HH71lc , HLH  \,, H gYA,,,$H  =<,, LL RIPPLESJJ PlP ,A - D @wes 0P  ,$ P- ll 1_Plain2% `` %%%Ripples 57 - September 1999x P  @? P-\ P H   YAM,, HH !YAX7,, HpH cXYADB,, H !YA5,, tH Z7,,JDD RIPPLES P ,_ P-0l@$@ P ,$ P-8ddl '1_Plain1% hh---Ripples 57 - September 1999yowlaPP @c P-\J@H!  =<,,JLL# RIPPLESJJ P$ ,A - D d@%wes PP& ,$ P- lpl'51_Plain2% `(%%%Ripples 57 - September 1999x pP) @\ P-\ HH*  YAM,,JH+ !YAX7,, HH, cXYA,,pH/  =<,, ($D1 RIPPLES PP2 ,_ P-0 @@3 P4 ,$ P- pl5'C1_Plain1% hh6---Ripples 57 - September 1999yowla P,P7 @c P-\ H8  YAM,, H9 !YAX7,, HH: cXYA,,JHH=  =<,,JLL? RIPPLESJJ P@ ,A - D @Awes PPB ,$ P-JplC5R1_Plain2% ``D%%%Ripples 57 - September 1999x4PE @\ P-\THL  =<,, DDN RIPPLES PPO ,_ P-0 @P pPQ ,$ P- llRCa1_Plain1% hDhS---Ripples 57 - September 1999yowla PT @c P-\ p H[  =<,,JLL] RIPPLESJJ P^ ,A - Dd@@_wes P` ,$ P-plaRp1_Plain2% ``b%%%Ripples 57 - September 1999x4Pc @\ P-\pHj  =<,, DDl RIPPLES PPm ,_ P-0 @n pPo ,$ P- llpa1_Plain1% hDhq---Ripples 57 - September 1999yowla Pr @c P-\ @0Hy  =<,,JLL{ RIPPLESJJ P| ,A - D d\@}wes PP~ ,$ P- + lplp1_Plain2% `%%%Ripples 57 - September 1999x pP @\ P-\ HH  YAM,,JhH !YAX7,, HH cXYA,,pH  =<,,$D RIPPLES PP ,_ P-0 @@ P ,$ P-(( pl1_Plain1% hh---Ripples 57 - September 1999yowla P,P @c P-\ H  =<,, pL RIPPLESJJ PP ,A - D @@wes P ,$ P- +Jpl1_Plain2% ``%%%Ripples 57 - September 1999xPP @\ P-\RIPPDD RIPPLES P ,_ P-0 P$@ PP ,$ P- +J$l1_Plain1% hh---Ripples 57 - September 1999yowla,P @c P-\ LL RIPPLESJJ PP ,A - D @d@wes P ,$ P- +J4:l1_Plain2% ``%%%Ripples 57 - September 1999x PP @\ P-\ H  YAM,,hHH !YAX7,, H cXYA,, p@H  =<,,JDD RIPPLES P ,_ P-0 l$@ PP ,$ P- + lpl1_Plain1% h---Ripples 57 - September 1999yowla,P @B P-\ LL RIPPLESJJ PP ,A - D @wes pP ,$ P- + ll1_Plain2% `D`%%%Ripples 57 - September 1999x P @\ P-\ h H  =<,,JDD RIPPLES P ,_ P-0l@@ P ,$ P- +p$l1_Plain1% hh---Ripples 57 - September 1999yowla,P @c P-\$pH  =<,, LL RIPPLESJJ PP ,A - D @wes pP ,$ P- + ll1_Plain2% `D`%%%Ripples 57 - September 1999x P @\ P-\  D RIPPLESJPP ,_ P-0 @JptLP ,$ P- + ll1_Plain1% hh---Ripples 57 - September 1999yowla P @c P-\ HH  YAM,, HH !YAX7,,pH cXYA,,$H   =<,, LL  RIPPLESJJ PP  ,A - D @wes pP ,$ P- + ll1_Plain2% `D`%%%Ripples 57 - September 1999x P @E P-\ pPD RIPPLES PP ,_ P-0 @@ P ,$ P- + pll.1_Plain1% hh ---Ripples 57 - September 1999yowla P,P! @c P-\ H(  =<,,JHpL* RIPPLESJJJPP+ ,A - D @,wes plP- ,$ P- + ll.E1_Plain2% `D`/%%%Ripples 57 - September 1999x P0 @\ P-\ H24  YAE?,, ll3  L VJWVJML L dd4 VJuL3,WVJ5, l5 WLWVJkLVJkLLWL 0H|H7 !YAX7,,JHH9: KgYA>,, H:;4  ,, "H;< ,, HH< YAO ,,JHH?  =<,,JDDA RIPPLES PB ,_ P-0 $d@C PPD ,$ P- + llE.V1_Plain1% hF---Ripples 57 - September 1999yowla ,PG @c P-\ HHH  YAM,, HhHI !YAX7,, HJK cXYAq,, tlHKL EYA|,, HHLM :?YA,,HHM /YAt,,HHP  =<,, LR RIPPLESJJ lLPS ,A - D @@Twes PPU ,$ P- + lVEd1_Plain2% D`W%%%Ripples 57 - September 1999x PPX @\ P-\ HPHY  YAtB,, HZ !YAX7,, H[ YA,, HH^  =<,,JDD` RIPPLESJPPa ,_ P-0 @b ,tPc ,$ P- + lldVv1_Plain1% hhe---Ripples 57 - September 1999yowla Pf @c P-\ HHg  YAM,, HHh !YAX7,, HpHij cXYA,, Hjk #AK,, llHkl NF#l,, HHlm c#,,HHm YAF ,,HHp  =<,, Lr RIPPLESJJ lLPs ,A - D @@twes PPu ,$ P- lvdx1_Plain2% D`w%%%Ripples 57 - September 1999x PPx @\ P-\ HPHyz YA,, Hz{fO",, 0 H{| :,,, HH|}9'f ,, HH} C'YA,, H  YAM<,,, pH !YAX7<,,, HH cXYArj<,,,pH YAN <,,,(H  D<,,, HH fD)e<,,, HpH  `A <,,,  W I/pp9p}K }A~0xV% X]7GLH0L XWge Wj)[A Uh/m< X]7%8 !!8g&g&g&g&x3f6IC3WQd2_frl3f6IC3WQd2_frl3f6IC3WQd2_frl3f6IC3WQd2_frlJ\'666btscmrosoftplutsid DD( bedshee 4`4)(' H2  =<0, , $H!8f&f&f&f&x3f6ID3WQd3_frl3f6ID3WQd3_frl3f6ID3WQd3_frl3f6ID3WQd3_frl NXWW kcW (@SlwAWCCbtsnsBOSWORTHboswrswkBWcastfldhildsroxtdavewsDHMsdgELWYeurofirfairboomzrtgladstes'ssruyhrstommowdnwdjaggJ-AprjeffulnkermnklgtbLCCltymMBCcLomeurosoftnsMPn{whovozpPADDY'SpatriatiulnhillutoemaPSrdtshroppkipttybridgeuwbrktaylshnyrosidswvVHFwhtakilkss DT alan 44UgTSJllxv1_Plain%  JL @ PP MHS\+ H\H  o0, ,  TX0+L90+L9B6^D\]xԃ X]7F @ PP .H\\+ HpH  \]x, , H  YAM,, H !YAX7,, HH cXYA,, HH  =<,, H  YAM,, pH !YAX7,, HH cXYA,,pH  =<,,,!8f&f&f&f&x3f6ID3WQd3_frl3f6ID3WQd3_frl3f6ID3WQd3_frl3f6ID3WQd3_frl !8f&f&f&f&x3f6ID3WQd3_frl3f6ID3WQd3_frl3f6ID3WQd3_frl3f6ID3WQd3_frl!8f&f&f&f&x3f6ID3WQd3_frl3f6ID3WQd3_frl3f6ID3WQd3_frl3f6ID3WQd3_frl @@JPP TGE\+ H  КJ(,H y  CК ||  N aNaN4aN yN+ N N dd aNEКaN~EК | NyNaNaN aN NN | RP /ON N RR HHN К |<| ? K  ? H? К x|     )    dd IК~IК ||   ?     H  CК <\HsDК HH6 К HpHtS/sDК H  К x @ PP 0KQ\+ HH  YAM H  !YAX7 p H   cXYA/ HH   u' HpH  YA/ H  ay 8@ PP -H \+ HH  YAM H !YAX7 pH cXYA HH ٸYAi HpH  [A^j @ HP -H \+ HH  YAM HH !YAX7 H  cXYA1 p H  YAh HH$  [A @p@% P& -H \+ H'  YAM HH( !YAX7 HH)* cXYA' H* YAF  pH.  [Acj @@/ PxP0 /H \+ H1  YAM H2 !YAX7 HH34 cXYA  HH4 YAF  H8  _A p @9 PP: -H \+ HpH;  YAM H< !YAX7 hH=> cXYAY HH> YAG JpHB  [A @@CxPD -H \+ @8HM  [A(} @@N PPO -H \+ HP  YAM h HQ !YAX7 HHRS cXYA%2 HpHST 3YA, HT YAG  HX  [A @@Y PPZ -H \+ H[  YAM hH\ !YAX7 HH]^ cXYApH^ !YA2  Hb ^7 HHd  [A_ @@e Pf -H \+ p Hg  YAM HHh !YAX7 HpHij cXYAN Hj YAG  @Hn  [A @@o PPp -H \+ Hq  YAM hHr !YAX7 HHst cXYAR HpHt YAG  Hx  [A @y PPz -H \+ HH{  YAM H| !YAU7 pH}~ cXYA HH~ !YA/ HpH T7 H  [A-